KEGG   Candidatus Arthromitus sp. SFB-mouse-NL: SFBmNL_01338Help
Entry
SFBmNL_01338      CDS       T03243                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
aso  Candidatus Arthromitus sp. SFB-mouse-NL
Pathway
aso00520  Amino sugar and nucleotide sugar metabolism
aso01100  Metabolic pathways
aso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SFBmNL_01338 (nagA)
Enzymes [BR:aso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SFBmNL_01338 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AID45241
Position
1366992..1368137
Genome map
AA seq 381 aa AA seqDB search
MLIKNVKLIFTDSIVPGSVVIQNGKIYKIFLNHNPRYEGEILDGEGLYLSPGFIDIHIHG
ASNHDTMDASYEGIIEISNTLLKHGVTSFLPTTMTCSKEDIRNALKNIYQIIKDNTSPNN
ILGVHLEGPFISKERIGAQNPEFLLEPSIDNFKEIVEDYEEIIKIVTLAPEIEGASNLIK
YLNDKKIVASIGHTNATYEEALCSIKNGISHATHLFNAMTPFTHRSPGVVGAILNSNITA
ECILDGIHIHYAALDMAIKIKSNNKIVLITDAMRACCMKDGNYTLGGQNVIVKDSNARLE
NGSLAGSVLTLNKAVYNVKNNLNIPLNEIIKLVTINPSKICKTQLTKGLIKEGYDADLVL
FDEDINIKHVFVNGNKKEGIS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgttaataaaaaatgttaaattgatatttactgattcaattgttcctggaagtgtagtt
atacaaaacggcaaaatatacaaaatatttttaaaccacaatccaagatatgaaggtgaa
attttagatggtgaaggactatacctatctcctggatttatagatattcatatacatggt
gcaagtaaccacgatactatggatgcatcttatgaaggtattatagagatatccaatact
ttattgaaacacggtgtaacatcatttcttccaactactatgacatgttcaaaagaagat
ataagaaatgctcttaaaaatatatatcaaataatcaaagacaatacatcacctaacaac
atactaggtgttcatttagaaggaccttttattagtaaggaaaggatcggtgcacaaaat
ccagaatttttgttagaaccatctatagataatttcaaagaaatagttgaagattatgaa
gaaattataaaaatcgtaactttagctcccgaaattgaaggagcatcgaatttaattaaa
tatttaaacgataaaaagatagtcgcatcaataggtcacactaatgcaacatatgaagaa
gctctatgtagcattaaaaatggtatatctcatgcaactcatctcttcaatgcaatgact
ccatttactcatagaagccctggagttgtaggtgcaatattaaattcaaatattacagct
gaatgtattttagatggaatacatatccattatgccgcactagacatggcaataaaaatt
aaatcaaataataaaatagtactaataacagatgctatgagagcatgctgtatgaaagat
ggaaactacacattaggaggtcaaaatgttatagttaaagattctaatgcaagacttgaa
aatggttctcttgcaggatcggtattaacattaaacaaagcagtatataatgtcaaaaat
aacttaaacatccctcttaatgaaataataaaacttgttaccataaatccatcaaaaata
tgtaaaactcaattaactaaaggactcataaaagaaggatatgatgcagatctagtatta
tttgatgaagacataaatataaaacacgtatttgttaatgggaataaaaaagaaggtatt
agctaa

DBGET integrated database retrieval system