KEGG   Aneurinibacillus soli: CB4_00865Help
Entry
CB4_00865         CDS       T05174                                 

Gene name
pspA
Definition
(GenBank) Phosphoserine phosphatase 1
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00860  Porphyrin and chlorophyll metabolism
asoc01100  Metabolic pathways
Module
asoc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CB4_00865 (pspA)
Enzymes [BR:asoc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CB4_00865 (pspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAU26722
UniProt: A0A0U5AWX3
Position
847763..848341
Genome map
AA seq 192 aa AA seqDB search
MKWIWMRHGETKENRERRYLGHYDAPLSASGRQQVEEAAALLGSEQITRVYTSDLLRCVE
TAAIMTAARQVVPVKIRELRELDFGHWDCNTYEEIMNDDPERAKSWYNNPYTTAPPGGET
LSMLGDRVDRFLRTLSLDMQTDETALLVSHGGPIRWFQAAWMTDKIEPFWQMLGVAPAGF
FAVRYNGDRWSR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatctggatgcggcatggcgagacgaaagaaaaccgggagcgccgctatctc
ggacattatgacgcaccgctttctgcatctggcagacagcaggtggaggaagcggcagct
cttcttggtagtgagcagatcactcgtgtatacacaagcgatctgctgcgctgtgtagag
acggcagcgattatgactgctgctagacaagttgtccctgtgaagataagagagctgcga
gaactggactttggacattgggattgtaacacatacgaagaaattatgaacgatgacccg
gaacgagcgaaaagctggtataataacccgtacacaacggcccctcctggcggtgagacg
ctctcgatgctcggtgaccgtgtagatcgctttctacgtacgttgtctctggatatgcaa
acggatgagactgctttacttgttagtcatggcggccccattcgctggtttcaggcggcc
tggatgacggataagatagaaccattctggcagatgctcggtgttgcgcctgctggtttt
ttcgctgtgcgttataacggagatcgctggagtagataa

DBGET integrated database retrieval system