KEGG   Aneurinibacillus soli: CB4_01686Help
Entry
CB4_01686         CDS       T05174                                 

Gene name
lspA
Definition
(GenBank) Lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc03060  Protein export
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CB4_01686 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:asoc01002]
    CB4_01686 (lspA)
Enzymes [BR:asoc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     CB4_01686 (lspA)
Peptidases and inhibitors [BR:asoc01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   CB4_01686 (lspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8 NrsF DUF4345
Motif
Other DBs
NCBI-ProteinID: BAU27512
UniProt: A0A0U4WFJ8
Position
1643475..1643939
Genome map
AA seq 154 aa AA seqDB search
MLYYMIALLVVLIDQGTKWLIVKTMTIGESIPLWEGVFNLTSHRNRGAAFGILQNRRVFF
IIITIVIIVGIIWYMRKVMRDNKLLALALALILGGAIGNFYDRLLTGEVVDFFDFTLIHY
PIFNVADSAIVIGVGLFILDVIRDMVVQRQEKNG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgttgtattatatgatcgcgctgctggtcgttctcattgaccaaggaacaaagtggcta
attgttaaaaccatgaccatcggtgagtccattccgctctgggaaggtgtgtttaatctg
acttcacaccgcaaccggggagcagcctttgggattttgcagaatcggcgagtgtttttt
atcatcattacgattgtgattattgtggggattatctggtacatgcgcaaagtaatgcgt
gataacaaactgcttgccttggcgcttgcgttgatcttgggtggggcgattggtaatttt
tatgatcgcttgctgacaggtgaagtggttgatttctttgattttactttgattcactac
ccgatctttaatgtggcggattcagccattgtaattggggttggattgtttattcttgat
gtgatacgcgatatggtagtacaacgacaggagaaaaatggatga

DBGET integrated database retrieval system