KEGG   Aneurinibacillus soli: CB4_03347Help
Entry
CB4_03347         CDS       T05174                                 

Gene name
gbsA_3
Definition
(GenBank) Betaine aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00010  Glycolysis / Gluconeogenesis
asoc00071  Fatty acid degradation
asoc00280  Valine, leucine and isoleucine degradation
asoc00310  Lysine degradation
asoc00330  Arginine and proline metabolism
asoc00340  Histidine metabolism
asoc00380  Tryptophan metabolism
asoc00410  beta-Alanine metabolism
asoc00561  Glycerolipid metabolism
asoc00620  Pyruvate metabolism
asoc00625  Chloroalkane and chloroalkene degradation
asoc00903  Limonene and pinene degradation
asoc01100  Metabolic pathways
asoc01110  Biosynthesis of secondary metabolites
asoc01120  Microbial metabolism in diverse environments
asoc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CB4_03347 (gbsA_3)
   00053 Ascorbate and aldarate metabolism
    CB4_03347 (gbsA_3)
   00620 Pyruvate metabolism
    CB4_03347 (gbsA_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CB4_03347 (gbsA_3)
   00561 Glycerolipid metabolism
    CB4_03347 (gbsA_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CB4_03347 (gbsA_3)
   00310 Lysine degradation
    CB4_03347 (gbsA_3)
   00330 Arginine and proline metabolism
    CB4_03347 (gbsA_3)
   00340 Histidine metabolism
    CB4_03347 (gbsA_3)
   00380 Tryptophan metabolism
    CB4_03347 (gbsA_3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CB4_03347 (gbsA_3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CB4_03347 (gbsA_3)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CB4_03347 (gbsA_3)
Enzymes [BR:asoc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CB4_03347 (gbsA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAU29166
UniProt: A0A0U5BLV5
Position
complement(3276494..3277984)
Genome map
AA seq 496 aa AA seqDB search
MQLASPSLNPNVESFLKGPKKLLINGQWVESSSGQTFETINPATKEVLCQVADGNAEDID
KAVKAARAALNGKWGRMTPSARGKLLYRLAELIEQNTEELAQLETLDNGKPIRETANADV
PLTVDHFRYYAGWATKIYGQTIPVSIPNFFNYTKREPVGVVGQIIPWNFPLLMAAWKLGA
ALACGNTVVLKPAEQTPLSALRLGELIMEAGFPDGVVNIVTGFGETAGQPLVDHYDVDKI
AFTGSTDVGRLIMRQAAGTLKKISLELGGKSPNIILPDADMSRAIPGALSGIFFNQGQVC
CAGSRLYVHKKVYDNVLSDMVDHAKKIKVGNGLLQDTQMGPLVSAEQFSRVSDYIDVGLK
EGAQRITAVESAEELANGYFVTPTVFSDVSDDMTIAQEEIFGPVLAAMPFDDIEDVIERA
NRTNYGLAAGVWTQNLSTAHKLADRIRAGTVWVNCYNVFDAASPFGGYKQSGIGREMGSY
ALEMYTEVKSVWINTK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgcttcgccatctttaaacccgaatgtagaatcattcctgaaaggcccgaaa
aaattgctcattaacgggcagtgggtagagtcttcctctggacaaacgttcgagaccatt
aacccggctacgaaagaagtactctgtcaggtggcggatggaaacgcggaagatattgat
aaggcggttaaggcggcacgagcagctctgaatggcaaatggggacgaatgaccccttcg
gcacgcggcaagctcctgtatcgactggctgagctaattgaacaaaatacggaagaactg
gcccaacttgagacactggataatggcaagccgattcgtgaaacggcgaatgcggacgtt
ccgcttaccgttgaccattttcgttattatgcgggatgggcaacaaaaatttatggacaa
acaattccggtatccattccgaatttctttaactatacaaaacgcgagccggttggcgta
gttggccagatcatcccgtggaacttcccgcttcttatggcggcgtggaagctgggtgcg
gctctcgcatgcggtaatacagtagtcttgaagccggcagaacagacgccgttgtcagca
ctgcgccttggtgaactgattatggaagcgggcttcccggatggcgtagtaaacattgtg
actggatttggcgagacggcaggacagccgcttgttgatcattacgatgttgacaagatt
gcgttcaccggttcaacggatgttggccgtctgatcatgcgtcaggctgccggcacactg
aagaagatttcccttgagcttgggggtaaatctccgaacattatcctgccagatgcggat
atgtcccgcgcgattccgggagcgctcagcggtattttcttcaaccaggggcaagtatgc
tgcgcaggctcccgtctgtatgtgcataaaaaagtgtacgataacgtgttaagtgacatg
gtagatcatgcgaagaaaattaaagtgggtaacggccttctccaggatacgcagatggga
ccactcgtatcagcggagcagttcagccgtgttagcgattatatcgatgttggtctgaaa
gaaggtgcacagcgcattaccgcagtggaaagcgcagaggagctggcgaatggctatttt
gtgacgccgacagtattctctgacgtatcagatgatatgacaatcgcgcaggaagaaatc
tttggcccggtgcttgcggcgatgccatttgatgacattgaggatgtaattgagcgtgcg
aatcgtacgaattatggactagcagcaggtgtgtggacacagaacctgtctaccgcacat
aaacttgcggaccgtattcgtgcgggcaccgtatgggtgaattgctacaacgtattcgat
gcagcatccccgtttggcggctacaagcagagcggcattggtcgggagatgggcagctat
gcgcttgaaatgtacacagaagtgaagagcgtgtggattaatacgaagtga

DBGET integrated database retrieval system