KEGG   Aneurinibacillus soli: CB4_03370Help
Entry
CB4_03370         CDS       T05174                                 

Gene name
lcfB_5
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00061  Fatty acid biosynthesis
asoc00071  Fatty acid degradation
asoc01100  Metabolic pathways
asoc01212  Fatty acid metabolism
asoc02024  Quorum sensing
Module
asoc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CB4_03370 (lcfB_5)
   00071 Fatty acid degradation
    CB4_03370 (lcfB_5)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CB4_03370 (lcfB_5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asoc01004]
    CB4_03370 (lcfB_5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asoc04147]
    CB4_03370 (lcfB_5)
Enzymes [BR:asoc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CB4_03370 (lcfB_5)
Lipid biosynthesis proteins [BR:asoc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CB4_03370 (lcfB_5)
Exosome [BR:asoc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CB4_03370 (lcfB_5)
  Exosomal proteins of breast cancer cells
   CB4_03370 (lcfB_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAU29189
UniProt: A0A0U5AZI5
Position
3295232..3296740
Genome map
AA seq 502 aa AA seqDB search
MLHEKIKGLHFGSFYLTHSKPEDAALIYHDQTITYGDLHTTVEKYATCLHVSGIRAGDVV
ALSCYNTPEFIYSYLAITRLGAIVAPLNLTLTIDELTYILQDSGAKALFIHEKILGKLSA
STEQLQAQFRLKEVLVIGEALTARVHTATAIEPPEINPKAIATLLYTSGTTGKPKGAMLS
HENLIADTVACTDVLDLTSQDVFMCVLPMFHSFGFTTSVLLPLYAGSTIVIHETFHPKEI
MHSLIAHHVSVFCGVPAMFVVLAQALKEGKVSFPSLRVAVSGGAALPVEILTLFSHQYNI
PLMEGYGLTEASPVVCFNPLHGEKKPGSVGLPLTGVEVRIADEQGGNLETDQTGEILVRG
LNVMQGYLNMPEATADTIVDGWLHTGDIGFIDSDGYVFIVDRKKDLIITRGLNVYPREIE
EVLYKHPAVLEAAVIGMPDPVKGEIVKAFVVPKPGETLDRRTVLDFLKPQLAAYKMPRFV
EIIDQLPKNAAGKILKKDLRKQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ttgctacatgaaaaaataaaagggcttcatttcggtagtttttatctcacccattccaaa
ccagaagacgcagctcttatctatcacgatcagacgattacgtacggagatcttcacaca
accgttgaaaaatatgctacctgtctacatgtatccggcattcgcgcaggtgatgttgta
gcattgagctgctataacacacccgagttcatttacagctatcttgcaatcacccgcctt
ggagcaattgtagccccactgaatttgacacttacaatcgacgagcttacatacattcta
caagattccggcgctaaagcgttatttattcacgaaaaaattctcggcaaattatctgcc
tcaaccgaacagcttcaagcacaattcagattaaaagaggttcttgtgatcggtgaggca
ttaaccgctcgcgttcatacagcgactgcgattgagcctccagaaatcaatccaaaggca
atcgctacccttctatatacatcaggtacaaccggtaagccaaaaggtgccatgctcagt
catgaaaatttgattgctgatactgtcgcctgcacagatgttctcgatctgacatcgcag
gatgtatttatgtgtgttctgccgatgttccactctttcggctttaccacatccgttctg
cttccgctttatgcaggttctaccattgtcattcatgaaacgttccatccaaaagagatc
atgcactctttgattgcgcatcatgtatcagtattttgtggcgtaccggctatgtttgtc
gtcctcgctcaggcactaaaagaaggcaaagtcagcttcccttctctgcgggtcgctgtt
tccgggggtgcagcgctgccagttgaaattttgactttgtttagtcaccagtacaatatc
ccacttatggaaggatacgggctgacagaagcatctccggttgtatgcttcaacccgttg
catggcgagaaaaagccgggctctgttggtcttccccttaccggtgtagaagtgcgtatt
gccgatgaacaagggggaaatctggaaacagatcagaccggtgagattctcgtacgtggg
ctaaatgtgatgcagggttacctgaatatgccggaagcaacagcagatacaatcgtggat
ggctggctccatacaggggatattggctttattgacagtgacggctatgtatttatcgtg
gaccgaaaaaaggacctgattattacgcgtggcctcaatgtctatccacgtgaaattgaa
gaggtactatataaacatccggctgttctcgaagcggcggttatcggcatgcccgatccg
gtcaagggagagatcgtcaaagcttttgtcgtaccgaagcccggagaaactctcgaccgc
aggaccgtgcttgatttcctgaagcctcaattggccgcatacaaaatgcctcgcttcgtg
gagatcatcgatcaactaccgaaaaatgcagctggtaaaatcctaaaaaaagacctgcgt
aaacagtag

DBGET integrated database retrieval system