KEGG   Acinetobacter soli: BEN76_00115Help
Entry
BEN76_00115       CDS       T04684                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asol  Acinetobacter soli
Pathway
asol00071  Fatty acid degradation
asol00072  Synthesis and degradation of ketone bodies
asol00280  Valine, leucine and isoleucine degradation
asol00310  Lysine degradation
asol00362  Benzoate degradation
asol00380  Tryptophan metabolism
asol00620  Pyruvate metabolism
asol00630  Glyoxylate and dicarboxylate metabolism
asol00640  Propanoate metabolism
asol00650  Butanoate metabolism
asol00900  Terpenoid backbone biosynthesis
asol01100  Metabolic pathways
asol01110  Biosynthesis of secondary metabolites
asol01120  Microbial metabolism in diverse environments
asol01130  Biosynthesis of antibiotics
asol01200  Carbon metabolism
asol01212  Fatty acid metabolism
asol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BEN76_00115
   00630 Glyoxylate and dicarboxylate metabolism
    BEN76_00115
   00640 Propanoate metabolism
    BEN76_00115
   00650 Butanoate metabolism
    BEN76_00115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BEN76_00115
   00072 Synthesis and degradation of ketone bodies
    BEN76_00115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BEN76_00115
   00310 Lysine degradation
    BEN76_00115
   00380 Tryptophan metabolism
    BEN76_00115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BEN76_00115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BEN76_00115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BEN76_00115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asol04147]
    BEN76_00115
Enzymes [BR:asol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BEN76_00115
Exosome [BR:asol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BEN76_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APV34514
UniProt: A0A1P8EE88
Position
complement(20597..21802)
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELKQRHQLDTAKVDDIVLGCVTP
VGDQGGDIAKTAAIAAGWSDNVAGVQINRFCASGLEAVNLAAQKVRSGWEDVVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGIGADLIATLDGYTRADVDAFAVGSQQKAAAA
QAQGYFDKSVVPVKDHSGVMILEKDEFIKGQTTLEGLAKLNASFEMMGQMGFDAVALQKY
PEAQKIHHVHHAGNSSGIVDGAAIVLIASEKAVKEQGLKPRAKVLATALVGTDPTIMLTG
PAPAARKALQKAGLTIDDIDLFEVNEAFAAVVMRFINELQVPEDKVNVNGGAIAMGHPLG
ATGAMILGTLLDELERQDKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcctacatcatcgatgccatccgcacgccacgtggaaaaggaaaaaaagat
ggctcactttatgaagtaaaacctatcaccttgctcacaaccttactcaatgaacttaaa
caacgccatcagctcgatacagccaaagtggatgatattgttttgggctgtgtgacgcca
gtgggtgatcagggtggcgatattgccaagaccgctgcaattgccgctggttggagcgat
aatgtggctggagtgcaaatcaaccgcttttgcgcttcaggcttggaggctgtgaatctg
gcagcacaaaaagtccgctcgggctgggaggatgttgtggtggctggcggtgtagagtcg
atgtcacgtattccaatgggatcagatggtggtccgtgggcgctcgatccagaaaccaac
ttaaaatcgtcttttgtgccacaaggcattggcgcagacttgattgcaactctcgatgga
tatactcgtgcagatgtcgatgcgtttgcagtcggttcacaacaaaaggccgctgcggcg
caagcgcaaggttatttcgataaatctgtcgtgcctgtaaaagatcattcaggcgtcatg
attttagaaaaagatgaatttatcaaaggtcaaaccacgctagaaggtttagccaaactc
aatgccagctttgaaatgatggggcaaatgggtttcgatgccgtagccctacaaaaatat
ccagaagcacaaaaaattcatcatgtccatcatgcgggaaattcatccggcattgtagac
ggtgcagccattgtacttattgcctctgaaaaagcagtcaaagagcaagggttaaaacca
cgcgctaaagtactggcaaccgcactggtcggtacagatccaaccattatgctgactggg
cctgcgcctgcagcccgcaaagccttacaaaaagccggcttaactattgacgatatcgac
ctatttgaagtcaatgaagcctttgcggctgtggtaatgcgttttatcaatgaactacag
gtgccagaagataaagtgaatgtgaatggtggtgcaattgccatgggtcacccactgggt
gcaacgggtgccatgattttgggcacactgctagacgaactagagcgtcaagataaaaaa
cgcgggctggccaccttgtgtgttggcggtgggatgggtatcgcgacgatcattgaacga
gtgtaa

DBGET integrated database retrieval system