KEGG   Acinetobacter soli: BEN76_05675Help
Entry
BEN76_05675       CDS       T04684                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
asol  Acinetobacter soli
Pathway
asol00633  Nitrotoluene degradation
asol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BEN76_05675
Enzymes [BR:asol01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BEN76_05675
  1.-  
   1.-.-  
    1.-.-.-  
     BEN76_05675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: APV35535
UniProt: A0A1P8EH45
Position
1157839..1158492
Genome map
AA seq 217 aa AA seqDB search
MDVLNVTQMRYTTKAYDASKKIPDHQFQRLLEILRLTPSSVNIQPWHFLIADNIEAKTRI
AKGLTGRYAYNAPKVLDASHSIIFCTRTDVTQEHLEQLLKQDDLNGRFKDEKAKEAQGQT
RAGYVEYYRNEQQNLYGWMENQTFIALGQLLLAAGLEGIDATPMGGFDEEIISQEFALAE
KGLRASVIVSLGYRSESDFNAQLPKSRLDDAVIFTTL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatgtattaaacgtcacacaaatgcgctacaccacaaaagcgtacgacgcttcaaaa
aaaattccagaccaccaatttcaacgcttactcgaaattcttcgtttaacaccgtcatcg
gttaatattcagccttggcattttttaattgcagacaatatagaagccaaaacacgaatc
gccaaaggactgacaggtcgttatgcctataatgcacctaaggtactagatgcttcacat
agcattattttttgtacgcgtactgatgtcacacaggaacatctagagcagctactcaaa
caagatgatttgaacggacgttttaaagacgaaaaagccaaagaagctcaaggtcaaact
cgcgcaggctatgtcgaatattatcgaaacgagcagcaaaatctttatggctggatggaa
aatcaaacctttattgcactgggtcagcttttactagcggcaggtttagaaggcatcgat
gccacgccgatgggtggattcgacgaagaaatcatcagtcaggaatttgcacttgctgaa
aaaggattgcgcgcatctgtcattgtgtcactaggctatcgtagtgaaagcgatttcaat
gcccaattacctaaatctcgcctcgatgacgcagttatttttaccacactttaa

DBGET integrated database retrieval system