KEGG   Acinetobacter soli: BEN76_05685Help
Entry
BEN76_05685       CDS       T04684                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
asol  Acinetobacter soli
Pathway
asol00010  Glycolysis / Gluconeogenesis
asol00030  Pentose phosphate pathway
asol00051  Fructose and mannose metabolism
asol00680  Methane metabolism
asol01100  Metabolic pathways
asol01110  Biosynthesis of secondary metabolites
asol01120  Microbial metabolism in diverse environments
asol01130  Biosynthesis of antibiotics
asol01200  Carbon metabolism
asol01230  Biosynthesis of amino acids
Module
asol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEN76_05685
   00030 Pentose phosphate pathway
    BEN76_05685
   00051 Fructose and mannose metabolism
    BEN76_05685
  09102 Energy metabolism
   00680 Methane metabolism
    BEN76_05685
Enzymes [BR:asol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BEN76_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: APV35537
UniProt: A0A1P8EH64
Position
complement(1159452..1160489)
Genome map
AA seq 345 aa AA seqDB search
MALISLRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADETNSPVIVQASAGARKYAGAP
FLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTSYDY
NVDVTRRVVELAHACGVSVEGEIGCLGSLETGLAGEEDGVGAEGVLDHSQLLTSVEEATQ
FVSDTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQD
WLKIINDNGGQIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFD
PRKYFAKTVDAMKQVCIERYQSFGTAGNADKIRPISLEAMVSRYK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcacttatctcattgcgccagctcttggatcacgctgcagaacataactacggcgta
ccagcgtttaatgtaaacaatcttgagcaaatgcgcgcgatcatgttggcagcggatgaa
accaactcacctgtaattgttcaagcttcggcaggtgcacgcaaatatgcaggcgctcca
tttttacgtcacttgattttggcagcaatcgaagaatggccacatattccagtggtaatg
catcaagaccatggaaccagccctgatgtatgtcagcgttcgattcagttgggctttagc
tcggttatgatggatggatcacttggtgcagatggtaaaacgccaacgtcttatgattac
aatgtcgatgtaacacgtcgtgttgttgaactcgcgcacgcgtgtggcgtatctgtagaa
ggcgaaatcggatgcttgggcagtcttgaaactggtcttgctggtgaagaagatggtgtc
ggtgcagaaggtgtattagaccattcacagcttttgacttctgttgaagaagcaactcag
tttgtttcagataccaatgtcgatgctcttgcaattgcagtaggtacttcacatggtgct
tacaagtttacccgtccacctacaggcgatatcttggcgattgaccgcattaaagaaatt
catgctgcgttgccaaatacacaccttgtgatgcacggttcaagttctgtaccacaagac
tggttgaaaattatcaacgataacggtggtcaaattggcgaaacttatggtgtgccagta
gagcaacttgttgaagcaatcaagcacggtgtacgtaaaatcaacatcgataccgattta
cgtttggcttcaaccggtgcaattcgtcgtttcatggcggaaaatcctgccgaatttgac
ccgcgtaaatattttgcaaaaactgttgatgcaatgaaacaagtatgtatcgagcgttat
caatcatttggtacagctggcaatgcagacaagattcgtcctatttctttagaagcgatg
gtaagtcgttataaataa

DBGET integrated database retrieval system