KEGG   Alteromonas stellipolaris LMG 21856: AOR13_1054Help
Entry
AOR13_1054        CDS       T04153                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00730  Thiamine metabolism
asp00790  Folate biosynthesis
asp01100  Metabolic pathways
asp02020  Two-component system
Module
asp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AOR13_1054
   00790 Folate biosynthesis
    AOR13_1054
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOR13_1054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asp04147]
    AOR13_1054
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:asp00537]
    AOR13_1054
Enzymes [BR:asp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AOR13_1054
Exosome [BR:asp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOR13_1054
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:asp00537]
 Enzymes
  AOR13_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme PglZ
Motif
Other DBs
NCBI-ProteinID: ALM90098
UniProt: A0A0S1YID1
Position
complement(1236767..1238680)
Genome map
AA seq 637 aa AA seqDB search
MKLFKLSIVALAVAGLTACSLEGDDGNDGAAGVDGSNGLNSLTVQTALAVGDANCPNSGV
QFDSGLDTNADGTLGSDEITDTSYVCSPGSSEVATGELLTTLNNDWFIAASAEVENNKQV
WMDATGTSASISSANIEVAQVANDEELQAMVADLRGKAKNVILFVGDGMGISTITAARIL
DGQLKGLDGEENQLSFGKFPFSGLSKTYNVDAQTPDSAGTMTAMVSGVKTDVGVIGVDED
IERGECSTVAGNELVTALELAEIAGKSTGIISTARITHATPAATYAKSADRNWEDISDMP
EDAVTAGCLDIADQLVNFETNLEANYEGLDVDGLEVVMGGGRRHFLPKDAAFNSIDAASE
VEGDRTDGRDLTAEWQEMYENGVYIVDQSGFDGLDTETTERVFGLFNESHMQYEADRGND
IAGEPSVAEMTEAAINILDNNDEGFFLMVESGRIDHAHHAGNAYGALYDTLAFADAVAMA
DELTNDEDTLIIVTADHGHVFTIAGYPKRGNPILGKVVNVGADEAATASDGTPYTTLGYT
NGLGFRNLGDETNSDAGYATAYDTGRKDLTDIDTTTPGYHQEALVPMGSETHSGEDVSIH
AKGPGAFLVNGTNEQSVIFHIMDFAGDFVTQADAVVE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttttaaattgagtattgttgcattagcagttgccggcctaaccgcttgctct
cttgaaggtgacgacggtaatgatggcgcagcaggagttgatggctcaaatggccttaac
agcttaaccgtgcaaactgcgttagcggtaggtgatgcaaactgcccgaatagcggtgta
cagtttgattctggcctagataccaatgcagatggcacgttaggtagcgacgagattacc
gatacaagctacgtttgttctccaggcagttctgaagttgcaaccggtgagctacttact
actttgaacaatgactggtttatagccgccagtgcagaagtggaaaacaacaagcaagtg
tggatggatgcgaccggcacctcagcaagcatatctagcgctaatatcgaagtagctcaa
gtagctaatgatgaagaattacaggctatggtagccgaccttcgcggtaaagcgaaaaac
gttattctgttcgttggtgacggcatgggcatttcaaccattacagccgcacgaattcta
gatggccaattaaaagggcttgatggcgaagaaaaccagcttagctttggtaaattccca
ttctctggactgtctaaaacgtataacgttgatgcacaaactccagactctgctggcacc
atgacagccatggtaagcggtgtaaaaacagatgtaggtgttattggtgttgatgaagac
attgagcgaggcgaatgcagtacggttgctggcaacgaactcgtaaccgcattagaactt
gcagaaatagcggggaaatctaccggtattatatctactgctcgtattactcatgctacg
ccagccgctacttacgccaagtcagccgatcgcaactgggaggatatatctgatatgcct
gaagatgcggttactgctggctgccttgatattgctgatcagctagtaaacttcgaaact
aacttagaagctaactatgaaggcttagacgttgatggcttagaagtagtaatgggtggc
ggccgccgccactttcttcccaaagatgctgcatttaatagtatagatgctgcaagcgaa
gttgaaggtgatagaacggatggccgagaccttaccgcagaatggcaagaaatgtatgaa
aatggtgtttatattgtcgaccaatctggttttgatggcttagacactgaaacgacagaa
cgcgtatttggtttatttaatgaatcgcacatgcaatatgaagctgatcgcggcaacgat
attgctggtgagccttcggtggcagaaatgactgaagcggctatcaatattcttgataat
aacgatgaaggcttcttccttatggttgaatcgggtcgtattgaccatgctcaccatgct
ggaaatgcttatggtgctttatacgacactttagcctttgcagatgctgttgccatggct
gacgagctgactaacgatgaagatacacttattattgttactgctgaccacggccatgta
tttaccattgcaggctaccctaaacgtggtaatcctatattaggtaaagtggtaaatgtt
ggcgctgatgaagccgctaccgcgtctgatggtacaccctataccacattgggttacacc
aatggtcttggcttcagaaaccttggcgatgaaaccaattcagatgcgggttacgctaca
gcgtacgatacaggtcgcaaagaccttactgatatcgacaccacaaccccgggttatcac
caagaagcgttagttccaatgggctcagaaactcactcaggagaagacgtgagtattcat
gctaagggccctggcgctttcctagtaaatggtacaaacgaacaaagcgtaatcttccat
attatggacttcgcgggtgacttcgttacccaagcagacgccgtagtggaataa

DBGET integrated database retrieval system