KEGG   Alteromonas stellipolaris LMG 21856: AOR13_1282Help
Entry
AOR13_1282        CDS       T04153                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00071  Fatty acid degradation
asp00072  Synthesis and degradation of ketone bodies
asp00280  Valine, leucine and isoleucine degradation
asp00310  Lysine degradation
asp00362  Benzoate degradation
asp00380  Tryptophan metabolism
asp00620  Pyruvate metabolism
asp00630  Glyoxylate and dicarboxylate metabolism
asp00640  Propanoate metabolism
asp00650  Butanoate metabolism
asp00900  Terpenoid backbone biosynthesis
asp01100  Metabolic pathways
asp01110  Biosynthesis of secondary metabolites
asp01120  Microbial metabolism in diverse environments
asp01130  Biosynthesis of antibiotics
asp01200  Carbon metabolism
asp01212  Fatty acid metabolism
asp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOR13_1282
   00630 Glyoxylate and dicarboxylate metabolism
    AOR13_1282
   00640 Propanoate metabolism
    AOR13_1282
   00650 Butanoate metabolism
    AOR13_1282
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOR13_1282
   00072 Synthesis and degradation of ketone bodies
    AOR13_1282
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOR13_1282
   00310 Lysine degradation
    AOR13_1282
   00380 Tryptophan metabolism
    AOR13_1282
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOR13_1282
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOR13_1282
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOR13_1282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asp04147]
    AOR13_1282
Enzymes [BR:asp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOR13_1282
Exosome [BR:asp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOR13_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALM90325
UniProt: A0A0S1YJ15
Position
1485443..1486624
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPTLGGHAIRNAVQRAGVDPASIDDVIMGAALTQ
GSGGMNISRLAALAGDLPVTVAGMTLDRQCSSGMYAIANAANSIRTGDTNIMVAGGLDSI
SLVQTKAMNMSRAVDPQLVAKHKNIYMPMLQTAEVVAQRYGISRDVQDEYAYQSQMRTAA
GQEAGKFDDEIVPITATKAIFNKETGETSEQEVTLSKDEGNRPETQLEGLRSLKPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGQAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgcagtaatagtaagtaccgcaagaacgcctattggccgtgcctataaaggt
gcactaaataatttaccagcccctacattaggtggtcatgctattcgcaacgcggtacaa
cgtgcaggtgttgatcctgccagtatcgacgatgtgatcatgggtgcagccctaacgcaa
ggcagtggcggcatgaacataagtcgcttagcggcattagcaggcgatttgccggtgact
gttgctggcatgacgttagacagacaatgtagctctggcatgtatgccattgccaatgcg
gcaaacagtattcgtactggcgacaccaatattatggtagcgggtgggttagattctatt
tctttggttcaaaccaaagccatgaacatgtctcgcgcggttgacccacaactagtggca
aagcataagaacatttatatgcctatgctgcaaactgctgaagttgttgcacagcgctac
ggtattagccgtgacgtgcaagatgaatacgcttatcaaagccaaatgcgcacagcggca
ggccaagaagcaggcaagtttgacgacgaaattgtgccaattacggccactaaagccatt
ttcaataaagaaactggtgaaacaagcgagcaggaagtgacgttatcgaaagacgaaggt
aaccgtcctgaaactcaacttgaaggtttgcgttcgctgaaacctgtgattgaaggcggt
tgtattactgcgggtaatgcgagtcaactgtctgatggtgctagtgctaccgtcattatg
gatgagcaatctgccgctaaaggtcaagcgcaaccattaggtatttaccgtggtattgcg
gtagctggatgtgaacctgatgaaatgggtattggccctgtatttgctattcctaaattg
ttaaagcaacacggcttaaccatggacgatattggtttgtgggaacttaacgaagccttt
gctgttcaagtgctttattgccgcgacaagctgggtattcctgatgaattactaaacgta
aacggtggtgcaatttcaattggtcacccttacggaatgagtggcgcacgtatggtgggt
catgcattaatcgagggcaaacgacgtggtgctaaatacgttgtttgtactatgtgtatt
ggcggcggtatgggtgctgctggtttatttgaagttatatag

DBGET integrated database retrieval system