KEGG   Alteromonas stellipolaris LMG 21856: AOR13_1689Help
Entry
AOR13_1689        CDS       T04153                                 

Definition
(GenBank) Acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00071  Fatty acid degradation
asp00280  Valine, leucine and isoleucine degradation
asp00410  beta-Alanine metabolism
asp00640  Propanoate metabolism
asp00650  Butanoate metabolism
asp01100  Metabolic pathways
asp01110  Biosynthesis of secondary metabolites
asp01120  Microbial metabolism in diverse environments
asp01130  Biosynthesis of antibiotics
asp01200  Carbon metabolism
asp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AOR13_1689
   00650 Butanoate metabolism
    AOR13_1689
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOR13_1689
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOR13_1689
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOR13_1689
Enzymes [BR:asp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     AOR13_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M AcylCoA_DH_N Acyl-CoA_dh_N Acyl-CoA_dh_2 DUF2066
Motif
Other DBs
NCBI-ProteinID: ALM90724
UniProt: A0A0S1YJS8
Position
complement(1962681..1964483)
Genome map
AA seq 600 aa AA seqDB search
MADQLIPRREMQFQLYEVLNTQSLCEKARFEEHNVETFNAVIDMAEKMAEELFLPHNAIA
DKDEPTFDGKKVTMIGEVKKAFDTYRESGFIAGHFDYEDGGMQLPVTIMNACAGYFLAAN
PSTTAYPFLTAAAANVVKHFANEETKQAFLPKMLTGDFTGTMALTEPHAGSGLADIRTSA
TLNEDGTYRVKGSKLYISAGEHELSDNIVHLVLAKIPGGPAGVKGISLFVVPKYRLDEDG
NPGPRNDVTLAGLIHKMGYRGTTSTALTFGENGDCHGYLVGEPHQGLRYMFMMMNEARIG
VGYGAAMIGYRGYRYSLEYAKDRTQGRAAPKLAPEDEATPIINHGDVRRMLLAQKSYCEG
GMALCLYGSTLIDALETEEDTAKRTEISQLLELLTPVFKAWPSEFGPKANDLAIQILGGA
GYTREYPVEQCWRDNRLNPIHEGTNGIQALDLLGRKLWQSEGKGLQVLLARVSGDMKAAT
TPRAQVLAAKLKPYLDQLGGLIQQAAGDLRSDKQAVLLTNASCFLNVFSACVVSWIWLRQ
ANVAEQALLNGASGQDGDFYEGKMAAAEYFLNWELPLVKRDIEVITSQEPTCENVKASYF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaacttattccccgtcgggaaatgcaattccaactttacgaagtattaaat
acccagtctttgtgtgaaaaggcccgttttgaggaacataacgttgaaacgtttaatgcc
gttattgatatggcagaaaaaatggctgaagagctgtttctacctcataacgctatcgcc
gataaagatgagcctactttcgatggcaaaaaggtcaccatgataggtgaggttaaaaaa
gcctttgatacttatcgtgagtcgggctttattgcgggtcacttcgattacgaagatggc
ggaatgcagttacccgttaccattatgaatgcatgtgctggttacttcttagccgccaac
ccttccactactgcgtatccttttcttactgctgccgccgcaaatgtggttaagcatttt
gccaacgaagaaaccaagcaagcctttttgcctaaaatgctcacaggtgattttaccggc
actatggcattaactgagcctcatgccggctctggactagcagatattcgcacgtcggcg
acccttaacgaagatggtacgtatcgcgtgaagggcagcaagctttatatctctgctggc
gaacacgaattatcggacaacattgttcatttggtcttagcgaaaattccaggcggtcct
gcgggcgtaaaaggtatttcgttatttgttgtccctaagtaccgtttagatgaagacggc
aacccaggcccccgtaacgacgttacgctagctgggctaatacacaagatgggttatcgc
gggacgacttctaccgcgcttacgtttggtgagaacggtgattgtcatggttacctagtg
ggtgagccgcaccaaggcttgcgttatatgtttatgatgatgaacgaggcgcgtattggt
gtaggttacggtgctgctatgattggttatcgcggctatcgctattctcttgagtatgca
aaagacagaactcaaggccgtgcagcgccaaaattagccccagaagatgaggctacgcca
attattaaccatggtgacgtgcgtcgcatgttgttagcgcagaagtcgtattgtgaaggc
ggcatggcactttgtttatacggtagtaccttaattgatgcgttagaaacggaagaagac
accgcgaaacgtaccgaaatttcccaattgctcgagctacttaccccagtatttaaagcg
tggccttctgaatttggccctaaagctaacgacttagccatccaaattctaggtggcgct
ggttatacccgtgaataccccgtagagcagtgctggcgtgataaccgtttgaaccctatt
catgaaggtacaaacggtattcaagcgctagatttactcggtcgtaaattatggcaaagc
gaaggaaaagggcttcaagtgttactcgcacgtgtatctggcgacatgaaagcggctaca
acaccgcgggctcaagtgttagcggcgaaacttaaaccttatcttgatcaacttggcgga
cttattcagcaagcggctggtgacttacgttcagacaaacaagccgtgttacttaccaac
gcaagctgctttttgaatgtattttcggcctgcgtagtgagttggatatggttacgccaa
gcaaatgttgccgagcaagcattgcttaacggcgcaagtggccaagacggcgatttctat
gaaggaaaaatggcagcagctgaatacttccttaattgggaattaccgctagtaaaacgc
gatatagaagtcattacgtcacaagaaccaacttgtgaaaatgtgaaagccagttatttc
taa

DBGET integrated database retrieval system