KEGG   Alteromonas stellipolaris LMG 21856: AOR13_1939Help
Entry
AOR13_1939        CDS       T04153                                 

Definition
(GenBank) Beta N-acetyl-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00520  Amino sugar and nucleotide sugar metabolism
asp01100  Metabolic pathways
asp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOR13_1939
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AOR13_1939
Enzymes [BR:asp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AOR13_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ALM90969
UniProt: A0A0S1YKH8
Position
complement(2245299..2246369)
Genome map
AA seq 356 aa AA seqDB search
MGPLMLDCQAERLLPEEKEKLAHPVVGGVILFSRNFYDCEQLTQLVKEIRESANRPLLIA
VDHEGGRVQRFREGFTKLPAMGKLTGLVQAQAAGKDIHWTELPEEEQDVEETVVNQATLE
LAKACGTIMAHELKQIDIDFSFAPVLDINGVSQVIGDRAFAETAEKVIPLASALIEGLQV
ANMPAIGKHFPGHGSVAPDSHVALPIDERPLEEIKQTDMVVFERLISKQLLDGVMPAHVI
YSQVDSKPAGFSEHWLQKILKQDLGFNGAVFSDDLSMHGASVAGNYVDRAQAALSAGCHM
VLACNNPKGAESILDALPHSTDSFEALTSLYGRKPAVHASAAYKNALKVLSRYGIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgttaatgcttgactgtcaggcagagcgtttattgcctgaagagaaagaaaaa
ctagcacatcctgtggtgggcggcgtcatactttttagccgtaatttttacgattgcgag
caacttactcagttagtaaaagaaattcgagaaagtgccaataggcctttgttaatagcg
gtagatcacgaaggtggcagggttcaacgttttcgtgaagggtttaccaagttacccgct
atgggcaagttaacggggttggtacaggcgcaagctgcgggtaaagatattcactggacc
gagttacccgaagaagagcaggacgtagaagagactgtagtcaaccaagccacactagag
ttagctaaagcgtgcggcaccattatggcccatgagctaaaacagatagatatcgatttt
agttttgcccctgtgcttgatattaacggtgtatcgcaagtgattggcgacagggcattt
gccgaaactgcagaaaaggttattccacttgccagtgcgctaatagaaggcttgcaagtt
gcaaacatgccagctattggaaaacattttccggggcatggcagtgtggctcccgattct
catgtggcattgcctatagacgaaagaccccttgaagaaattaaacaaactgatatggtt
gtttttgaaagattaatttctaaacagttgctagatggtgtaatgccagcgcacgttatt
tattctcaagttgatagcaagccagccggtttttccgaacactggttacaaaaaatatta
aagcaagacttgggctttaacggtgcagtgttctctgatgacctgtctatgcacggtgcc
agtgttgccggaaattatgtcgatcgtgcccaagcggcattatcagcaggttgccatatg
gtattggcatgtaacaacccgaaaggggcggaatctattttagatgcgctgccccattca
acagactctttcgaggctttaacctcactttacgggcgcaaaccagctgtgcatgccagt
gcagcttataaaaacgcattaaaggtgttgtcgcgctatggaatcggttaa

DBGET integrated database retrieval system