KEGG   Alteromonas stellipolaris LMG 21856: AOR13_2395Help
Entry
AOR13_2395        CDS       T04153                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00380  Tryptophan metabolism
asp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AOR13_2395
Enzymes [BR:asp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     AOR13_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: ALM91404
UniProt: A0A0S1YLV1
Position
complement(2759433..2760521)
Genome map
AA seq 362 aa AA seqDB search
MKKNIEPCYYGDYLALDKILGAQKLQSTKYGEPAHEEMLFIVVHQVYELWFKQLLHELNA
VIDTFNQAAVKDQQLTSVVHRLHRVIQIQKLMNDQIGIMETMTPQQFLSFRDYLVPASGF
QSIQFKQLEISLGLKREYRIDFDKQSFYNRLSDDDRSLLEALEEKPSLFELVDKWLARMP
LLKTEDFHFWDYYRKATDEMLNDDKETIERNAFLSEVERRQELKDWQSTRENFDGLFNHE
TYEDLLNQGKFRLSHEALLSALFIKQYSEEPVFNLPFQLITALTEIDEQLTLWRYRHAMM
VQRMLGTKIGTGGSSGHHYLKKTTESNRIFLDFFNMATFLLPKSSLPELPESVKRRLGFY
LQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatatagaaccctgctattacggtgattacctagcattagataaaatactt
ggcgcacaaaagcttcaaagtactaagtacggcgaacctgcccatgaagaaatgctattt
atcgtagtgcaccaagtgtatgaactatggtttaagcaactcttgcacgaactcaatgcg
gttatcgatacatttaaccaagctgcagtaaaagatcagcaactcacttcggtggtacat
aggctgcatcgcgttattcaaattcaaaagctgatgaacgaccaaattggcatcatggaa
accatgacccctcaacagtttctttcctttagagactatttggttcccgcttcaggcttt
caaagtattcaattcaagcagcttgaaatttcgttgggccttaaaagggaatatcgtatc
gatttcgataaacaaagcttttataaccgtttaagtgatgatgatcgcagtctactggaa
gccttagaagaaaagccaagcttgttcgagttagtggataagtggttggcacgtatgcca
ttacttaaaaccgaggatttccacttttgggattactaccgaaaagcaacagatgaaatg
ctaaacgatgacaaagaaaccatagaaagaaatgcgtttctgtctgaggtagagcgtcga
caggagcttaaagactggcaatcgaccagagaaaactttgatgggctatttaaccatgaa
acgtatgaagatcttcttaatcaggggaaattccgcttgtctcatgaagcattgttgtcg
gctttatttataaagcagtattcagaagagcctgtttttaatctgccgttccaacttatt
actgcgctaacagaaatagatgagcaattaacgttgtggcgttatcgccatgccatgatg
gtgcaacgaatgctgggtactaaaataggaactggagggtcatctggccatcattatttg
aagaaaaccactgaatcaaacaggatatttttagactttttcaacatggctacgttcctt
ttaccaaaaagttcacttccagaattgcctgaatcggtaaaacgcaggttagggttttat
ttacaatag

DBGET integrated database retrieval system