KEGG   Alteromonas stellipolaris LMG 21856: AOR13_2924Help
Entry
AOR13_2924        CDS       T04153                                 

Definition
(GenBank) Aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00620  Pyruvate metabolism
asp00630  Glyoxylate and dicarboxylate metabolism
asp01100  Metabolic pathways
asp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOR13_2924
   00630 Glyoxylate and dicarboxylate metabolism
    AOR13_2924
Enzymes [BR:asp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AOR13_2924
    1.2.1.22  lactaldehyde dehydrogenase
     AOR13_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ALM91928
UniProt: A0A0S1YNA8
Position
3391646..3393097
Genome map
AA seq 483 aa AA seqDB search
MYPHNKKHFINGEYVSSASEEHISITSPSTGKRVGDIPFGCEEDAQSALDAAQNAQRAWA
LKTARERATVLRKFAQLIREHTDTLAPLLVSEQGKLIGVAEMEVAVTASFIDYACDNALT
IRGDILPSDNDNEKIYIHKVPRGVVVAITAWNFPLALAGRKIGPALITGNTLVLKPTEET
PLATLMLGELAIKAGIPKGVLNILNGTGVSVGQFLCESPITKLITMTGSTRAGEKIYQSA
GKNMIPVMLELGGKAPFIVMDDADLEKAANDLIDTRFANCGQVCTCAERLYVHEDVYDAF
IATLLPKVKSIKVGDPMHPDTQMGPKINAREITNISKLLKDGLNQGATILCGGKEANVDG
FEKGHWFEPTLVGNVSHDNVLMHEETFGPILPVMKIASIEQAIEFTNDSEYGLSAYLYTS
SLKHINKAIAEMEVGEVYVNRGIGEQHQGFHNGWKKSGMGGEDGLYGLEQYLDKKTIYMH
EPT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtacccacataacaagaagcattttattaatggtgaatatgtaagctctgcttctgaa
gagcatatctcaattacgagcccgagcaccggtaagcgagtgggtgacattccttttggt
tgtgaagaagacgcgcaaagtgccctggacgcagcgcaaaacgcgcagcgtgcgtgggct
ttaaagaccgcgagagaaagagccaccgtgttacgtaaatttgcacagctgatcagggag
cacaccgacaccctagcgcccttgctagtaagtgaacaaggcaaactaattggcgttgca
gaaatggaagtggcagtaaccgcaagttttatcgactatgcgtgtgacaatgcgctaacc
attcgcggtgatattcttccttcagacaatgacaatgaaaaaatatacattcataaggtg
cctcgtggggttgtagtggcaattaccgcgtggaatttccctttggcattggcaggacgg
aagataggccctgcccttatcaccggaaacacactggtattgaaacccaccgaagaaacg
ccacttgccacgctcatgttaggtgaattagcgataaaagcagggatccctaaaggcgtt
cttaatattcttaatggtacaggtgtttcggttgggcaattcctttgtgaaagcccgatt
accaagcttatcaccatgacgggaagtacccgagcaggtgaaaaaatctatcaatcagcc
ggtaagaacatgataccggtgatgttagaacttggtggtaaggcgccattcattgtcatg
gatgatgcagacctagaaaaagcggccaatgacctaatcgacactcgcttcgccaactgt
ggccaagtgtgtacctgcgcagagcgtctttatgtacatgaagatgtatacgatgccttt
attgcaacgcttttacctaaggtgaagtcgattaaggtgggcgatcctatgcatcctgat
acccagatggggccaaagattaacgcccgtgagattactaatataagcaaactcttaaaa
gacggtctaaaccaaggtgcaacaatcttgtgcggcggtaaagaagcaaatgttgatggc
tttgaaaaaggccactggtttgagccaaccctagtgggcaatgtttctcacgacaatgtg
ttaatgcatgaagaaaccttcggaccaatcctgcccgtcatgaaaatagccagtatcgaa
caagctattgagtttactaacgacagtgagtatggcctttccgcctacctctatacctct
tcactaaaacatataaacaaagctattgcagagatggaagtgggtgaagtgtatgtaaac
cgtggcatcggtgagcagcaccaaggctttcacaatggctggaaaaaaagtggaatgggt
ggcgaagatggtttgtacggcctagagcagtacctagataaaaaaaccatttatatgcac
gaaccaacctaa

DBGET integrated database retrieval system