KEGG   Alteromonas stellipolaris LMG 21861: AVL57_05315Help
Entry
AVL57_05315       CDS       T04545                                 

Definition
(GenBank) inorganic phosphate transporter PiT family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
asq  Alteromonas stellipolaris LMG 21861
Brite
KEGG Orthology (KO) [BR:asq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AVL57_05315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMJ73441
Position
993674..994942
Genome map
AA seq 422 aa AA seqDB search
MEFFESYGLILILLAAGVGFIMAWGIGANDVANAMGTSVGSKALTIKQAIVIAMVFEFAG
AYLAGGEVTSTIRKGIIDPEYFSAIPEYLVLGMISSLFAAGIWLAFASWLGWPVSTTHSI
IGAIIGFTATGVSMDAVAWGKVGGIVGSWVVTPAISGIIAYLIFMSAHKLIFETKSPFEN
AKRYVPFYMALAGFIMSLVTIKKGLKHVGLEMSAMNGYILAVVIAIILAIIGKWFIGRMK
FSGSEDADLQAANVEKVFALLMVVTACCMAFAHGSNDVANAIGPLAAVVSVVTSGGEINA
NANLAWWILPLGGLGIVLGLAIFGHRVIKTIGQGITHLTPSRGFAAELAAATTVVIASGT
GLPISTTQTLVGAVLGVGLARGVSALNLGIVRNIVVSWIVTLPAGAILSIIFFFALKAAF
GV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggaatttttcgagagttatggtctcattcttattctccttgctgccggtgtcggcttc
attatggcttggggtattggtgcaaatgacgtcgccaatgcaatgggaacatctgttggt
tctaaagcgttaacgataaaacaggcaattgtcattgccatggtttttgaattcgccgga
gcatacttagcgggtggggaagttacttctaccattcgtaagggtattattgatccagag
tatttttctgctattcctgagtaccttgtgctcggtatgatttcttccttgtttgcagca
ggtatctggttagcctttgcatcttggttgggatggcctgtatctaccactcactctatt
atcggcgctattatcggtttcaccgcaactggcgtaagtatggacgcggttgcatggggc
aaagtaggtggtattgttggtagttgggtagtaacgcctgctatttcgggcattattgct
tacctcatcttcatgagtgcccataaacttatatttgaaaccaaatctccgtttgaaaat
gccaagcgttatgttccgttttatatggcactagcaggcttcattatgtcgctagttacc
attaaaaaagggctaaagcacgtgggcttagaaatgagtgccatgaacggttatatattg
gctgtggttatcgctattattttggccatcattggtaagtggtttattggtcgcatgaag
ttcagtggttcagaagacgctgatttacaagctgccaacgtagaaaaagtattcgcctta
ctgatggtagtgactgcctgctgtatggcttttgcgcacggctcaaacgatgttgctaac
gctattgggccattggctgcggtagtgagtgttgtgacatctggcggagaaattaatgcc
aatgctaacttagcatggtggattttacctttaggtggcttgggtattgtgcttggttta
gccatattcggtcatcgcgtaattaaaactattggccaaggtattactcatcttacgcca
agccgtggtttcgccgctgaattagccgccgccacaaccgtagtgatagcgtcaggcaca
ggccttcctatttcgactacgcaaaccttggtaggtgcagttttaggagtagggcttgct
cgaggcgtgtctgcgcttaatcttgggatagtaagaaatatcgtggtgtcgtggattgtt
accctgcctgcaggcgctatcctttctattattttcttcttcgcactaaaagcagccttc
ggcgtttaa

DBGET integrated database retrieval system