KEGG   Alteromonas stellipolaris LMG 21861: AVL57_07075Help
Entry
AVL57_07075       CDS       T04545                                 

Definition
(GenBank) kinase
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq00260  Glycine, serine and threonine metabolism
asq00561  Glycerolipid metabolism
asq00630  Glyoxylate and dicarboxylate metabolism
asq01100  Metabolic pathways
asq01110  Biosynthesis of secondary metabolites
asq01130  Biosynthesis of antibiotics
asq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AVL57_07075
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AVL57_07075
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AVL57_07075
Enzymes [BR:asq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     AVL57_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_18 AAA_14 MeaB AAA_29 Zeta_toxin KAP_NTPase AAA_23 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AMJ73761
Position
1412963..1413844
Genome map
AA seq 293 aa AA seqDB search
MDIHGFLKTHQLPSTYADTAQKWFIPLCERLVKHQESAGDSSKAPLVVGINGCQGSGKST
LTDFISAYLTSIYSKKVVCLSIDDFYLDKSQRNALSIKVHPLLATRGVPGTHNMPLALDT
FKQLKGSDQVALPRFNKAIDNPFPVNQWPVISAPPDIIILEGWCVGVTPQNAADMKQPIN
SLEENQDPLGIWRSFVNTELSNDYQSLFDQIDYRVMLKAPSFECVYRWRLEQEHKLAVAT
QGASTGVMSDEQVAQFIQNYQRLTEHALKTLPTKCDTVYSLDETRTITGEEVK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggacatacatgggtttttaaagacacatcagctaccaagtacgtatgcggacactgca
caaaaatggttcatcccattatgcgaacggctagttaagcaccaagagagtgcaggagat
tcaagtaaagccccattggtggtcggaattaacggctgccaaggttcgggtaaatctacg
ctaactgattttataagcgcatatttaaccagcatttattccaaaaaagtggtttgtctt
tctattgatgacttttatttagacaaatcgcagcgaaatgcgctgtcgataaaagttcac
ccacttcttgcaaccagaggtgtgccaggtacacacaatatgccgctagcgcttgatacg
tttaagcagctcaaaggcagtgatcaagtagcccttccccgtttcaataaagccatagac
aacccctttcctgttaatcagtggcccgttatttctgcgccaccagatatcattattttg
gagggatggtgcgttggtgtaacaccacaaaacgctgccgacatgaagcaacccataaat
agtttagaagaaaaccaagatccacttggtatttggcgttcgtttgttaatactgaatta
tcaaatgactaccaaagcttgtttgatcaaatcgattatcgggttatgttaaaagcgccc
tcgtttgaatgtgtttatcgctggcggttagagcaagaacataaacttgctgtagcaacc
cagggggcttctacgggggtgatgtccgatgaacaggtcgcgcagtttattcagaattac
caacgactaaccgaacatgcacttaaaacattgccaacaaagtgtgacactgtgtattcg
ctagatgaaacaagaacgataacaggcgaggaagtaaagtaa

DBGET integrated database retrieval system