KEGG   Alteromonas stellipolaris LMG 21861: AVL57_08270Help
Entry
AVL57_08270       CDS       T04545                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq00071  Fatty acid degradation
asq00072  Synthesis and degradation of ketone bodies
asq00280  Valine, leucine and isoleucine degradation
asq00310  Lysine degradation
asq00362  Benzoate degradation
asq00380  Tryptophan metabolism
asq00620  Pyruvate metabolism
asq00630  Glyoxylate and dicarboxylate metabolism
asq00640  Propanoate metabolism
asq00650  Butanoate metabolism
asq00900  Terpenoid backbone biosynthesis
asq01100  Metabolic pathways
asq01110  Biosynthesis of secondary metabolites
asq01120  Microbial metabolism in diverse environments
asq01130  Biosynthesis of antibiotics
asq01200  Carbon metabolism
asq01212  Fatty acid metabolism
asq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVL57_08270
   00630 Glyoxylate and dicarboxylate metabolism
    AVL57_08270
   00640 Propanoate metabolism
    AVL57_08270
   00650 Butanoate metabolism
    AVL57_08270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AVL57_08270
   00072 Synthesis and degradation of ketone bodies
    AVL57_08270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AVL57_08270
   00310 Lysine degradation
    AVL57_08270
   00380 Tryptophan metabolism
    AVL57_08270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AVL57_08270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AVL57_08270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVL57_08270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asq04147]
    AVL57_08270
Enzymes [BR:asq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AVL57_08270
Exosome [BR:asq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVL57_08270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III DUF5417
Motif
Other DBs
NCBI-ProteinID: AMJ73972
Position
complement(1683579..1684754)
Genome map
AA seq 391 aa AA seqDB search
MSSETVVIVAAKRTPMGGFNGSLSGVAATELGATAIKSVCDTFDVNQVDEVIMGCVLPAG
LGQAPARQASLGAGLPLSAGVTTINKVCGSGLKAVMLAHDLIKAGSAEVVVAGGFESMSN
APYMLPKARTGYRMGHGQVLDHMMLDGLENAYDGKAMGCFAQDTADAENITRTQMDEFAL
NSLSKANEAINSGSFKDEIVNVTISGRKGDVVVDTDEGPGSARPEKIPSLRPAFKKDGTV
TAANSSSISDGAAALLVMSESKAQALGLTPLAKVVAHATHSIEPENFTVAPVGAMENVLS
KAGWSKDEVDLFEINEAFAMVTMLAVQKLGLDERRVNVKGGACALGHPIGASGARILVTL
LHALNQKKAKKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgaaacagtagtgatagtagcagcgaagcgcacaccaatgggaggcttcaat
ggtagtctgtctggggtagcagccaccgaactaggtgccactgccattaagtcggtgtgc
gacacattcgatgtaaaccaagttgatgaagttattatggggtgtgttctgcctgctggc
ttaggtcaagctccagctcgtcaggcatcgttaggcgcaggtcttcctcttagcgcaggc
gtaacaaccattaataaagtttgtggttctggtttgaaagcggtaatgctggctcacgat
ctaattaaggcgggtagtgctgaagtggttgtcgctggtgggttcgaaagcatgagcaat
gcgccttatatgttgccaaaggcaagaacaggctatcgcatggggcacggacaagtactc
gaccatatgatgctagatggccttgaaaatgcctacgacggaaaggcgatgggatgtttt
gcccaagatactgccgatgctgaaaatattacgcgtactcaaatggatgaatttgctctg
aactcgctttcaaaagccaatgaagcgattaacagcggcagtttcaaagacgaaatcgta
aacgtgactatttctggtcgtaaaggcgatgtggtcgttgatactgatgaaggcccaggg
tctgcgcggccagaaaaaataccatcacttcgcccagcgtttaaaaaggatggcacggta
accgcagcaaattctagctctatatcagatggcgcagcggctttattagtgatgagcgaa
tctaaagcgcaagcgctgggattaacgccgcttgcaaaagtggtggcgcatgctacgcat
tctatagagccagaaaatttcacggtagcaccggttggtgcgatggaaaatgtgctctca
aaagcaggttggtctaaagacgaggtcgacctgttcgaaattaacgaagcctttgccatg
gtaacaatgctggctgttcaaaaactgggattagacgagcgaagagtgaatgtgaaaggt
ggcgcatgtgcacttggccaccccattggtgcctcgggtgcgcgaattctggttaccttg
ctgcacgcgcttaaccaaaagaaagcgaaaaaaggcatcgcctctttatgtattggtggt
ggggaaggcgtagcacttgctgttgaaatgctataa

DBGET integrated database retrieval system