KEGG   Alteromonas stellipolaris LMG 21861: AVL57_11440Help
Entry
AVL57_11440       CDS       T04545                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
asq  Alteromonas stellipolaris LMG 21861
Brite
KEGG Orthology (KO) [BR:asq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:asq03009]
    AVL57_11440
Enzymes [BR:asq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AVL57_11440
Ribosome biogenesis [BR:asq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AVL57_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_31 Methyltransf_25 AviRa Methyltransf_23 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AMJ74525
Position
complement(2392519..2393382)
Genome map
AA seq 287 aa AA seqDB search
MWQCPLCRSPIDMSASVIQCSNNHSFDKAKAGYVNLLPVQFKNSKSPGDDKSMVRARREF
HDLNGYGPLKQRMTDIVAQYYTDTRSSDNADINAKPELAIYDAGCGEGSYLNALVIGLKA
KSIHTTGSGSDIAKIAVELAAKAYKSQQFVVASSFDLPIESNTQDVVIQVFAPGSSEEYT
RVLKAGGLLLTVDPAPMHLFELKSLVYDNPAKHAVEKEERVGFEQSMDETVNYPLHFDND
EQKIALIKMTPYYWRLPPDRLAEIVEELNQVTVDFRVQAWLKMPETV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaatgcccactttgccgaagcccaatcgatatgagtgcctcggtcattcaatgc
agcaataaccatagttttgacaaagcgaaagcaggctacgttaatcttcttcccgtacaa
tttaaaaattccaagtcacctggtgacgacaaaagtatggttcgcgcccgaagagagttc
cacgatctcaatggttatgggcccttaaagcagcgcatgacagatatagtggcgcagtat
tacaccgatacccgtagtagtgacaatgccgatatcaatgcaaagccggaacttgcgatc
tacgatgcagggtgtggcgaagggagttacctaaacgccctagtcataggtttaaaagcc
aaaagtattcacactaccggcagcggtagtgatatcgcgaaaattgcggtggaattagcg
gctaaggcgtataagtcgcagcagtttgttgtggccagtagctttgatttgcccattgaa
tcgaatactcaagatgtggttattcaggtttttgcccccggaagcagtgaagagtataca
cgtgtgttgaaagcgggtggtcttttgcttaccgtagacccagcacccatgcatttgttc
gagttaaaatcattggtatatgataaccccgcaaaacatgcggtagaaaaagaggagcgg
gtgggtttcgaacaatctatggatgaaacagtcaattatcccctgcatttcgataacgat
gaacaaaaaatcgcgttgattaaaatgacgccgtattactggcgtttaccaccggacaga
ttggcagaaattgttgaggagctaaaccaagtcaccgttgattttcgtgttcaagcttgg
ctaaaaatgccagagaccgtttga

DBGET integrated database retrieval system