KEGG   Alteromonas stellipolaris LMG 21861: AVL57_13780Help
Entry
AVL57_13780       CDS       T04545                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq00061  Fatty acid biosynthesis
asq00071  Fatty acid degradation
asq01100  Metabolic pathways
asq01212  Fatty acid metabolism
asq02024  Quorum sensing
Module
asq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:asq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AVL57_13780
   00071 Fatty acid degradation
    AVL57_13780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AVL57_13780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asq01004]
    AVL57_13780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asq04147]
    AVL57_13780
Enzymes [BR:asq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AVL57_13780
Lipid biosynthesis proteins [BR:asq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AVL57_13780
Exosome [BR:asq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AVL57_13780
  Exosomal proteins of breast cancer cells
   AVL57_13780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AMJ74941
Position
complement(2953942..2955594)
Genome map
AA seq 550 aa AA seqDB search
MEKTWLKFYDPRVSAEIDADRYASVVDIFEQSVKKFKDKVAFINMGQSMTFGELDKLSAQ
YAAYLQNSGLKRGDAVAIMMPNLLQYPVAMFGVLRAGMVVVNVNPLYTARELKHQLNDAN
AKAIVIVENFACTLEEVISETNIQEVFLTSLGDMLPVPKRWVVNAVVKYVKKMVPAFNLA
ATTSFTSAIKQGQSLTYTRPDLTNDELAFLQYTGGTTGVSKGAMLTHRNMIANLEQVSGI
LETVIDEGEDFVVTALPLYHIFALLANCLMFLKYGCQNLLITNPRDMPGFVNELSKYPFT
ILPGVNTLFNGLLNTPGFSELDFKNFKFGLGGGMAVQRPVAEKWEKVTGTVLLEGYGLTE
CSPVVTVNPPQIDAYKGAIGMPVPSTDIKLLDDDGNEVEKGEPGELWVKGPQVMKGYLNR
PEATDEILKDDWLATGDIATVDDEGYFYIVDRKKDMILVSGFNVFPNEIEEVAAMHDNIV
ESAAVGVPNEASGEVVKLFVVRNNDSLTAEAVIAHCREHLTGYKVPKQVVFKEDLPKTNV
GKILRRELRD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaacctggctcaagttttacgaccctcgtgtatctgcagaaattgatgcagat
cgttacgcatctgttgtcgatatattcgaacaatcagtaaaaaagtttaaagacaaagtt
gcgtttatcaacatgggtcagtcgatgacctttggcgaactcgacaagttatctgcacaa
tatgctgcctacctacaaaatagcgggttaaagcgcggtgatgccgtggcaatcatgatg
ccgaacttgcttcagtaccctgtagccatgtttggtgtacttcgtgctggtatggttgtg
gttaacgtaaacccgctgtacaccgcaagagagttaaagcatcagttaaatgatgcgaat
gctaaggcaattgttattgttgaaaactttgcgtgcacacttgaagaagtgatcagtgaa
acaaacattcaagaagtgtttcttacttcgctaggcgatatgctgcctgtaccaaaacgt
tgggtagtgaatgcggtagttaagtatgtgaaaaaaatggtgccggcttttaatttggca
gcgactacatctttcacaagcgctataaagcaagggcaatcgttaacctatacccgtcca
gatttaaccaacgatgaactggctttcttgcagtacaccggtggcaccacgggtgtatct
aaaggcgccatgctgacacatcgcaatatgattgcgaatcttgagcaagtttctggcatt
ttagaaaccgtaatagatgaaggcgaagacttcgtggtaaccgcgttgccgctttaccat
atattcgcattgcttgcgaactgcttgatgttccttaaatacggttgccaaaacttactg
attactaaccctcgtgatatgccagggtttgtaaacgaattgagcaaatacccttttact
attcttccgggtgtaaatactttgtttaacggcttgttaaacacaccagggtttagcgag
cttgattttaaaaactttaagtttggcttaggcggcggcatggctgttcaacgccctgtt
gctgaaaagtgggaaaaggttaccggtactgtacttcttgaaggttatggccttacggaa
tgctcgcctgttgtaacagtaaacccaccacaaattgacgcgtacaaaggcgccattggt
atgccagtaccttctaccgacatcaaacttcttgatgatgatggtaacgaggtagaaaaa
ggtgagccaggtgagctttgggtgaaaggcccgcaagtgatgaaagggtatttaaatcgc
ccagaagccactgacgaaattcttaaagatgattggcttgccaccggagacatcgccacg
gtagacgatgaaggttatttctatattgttgaccgtaaaaaggatatgatcctcgtctct
ggattcaatgtgtttccaaacgaaattgaagaagtggctgcgatgcatgacaacattgtt
gaatcagcagctgttggtgtgccaaatgaagccagtggtgaagtggtgaagttatttgtt
gttcgcaacaacgactcgctaactgctgaagcggtcattgcgcactgtagagaacactta
acgggctataaagtgcctaagcaggtagtcttcaaagaagatctacctaaaaccaatgta
ggtaaaattctgcgtcgggaactacgagattaa

DBGET integrated database retrieval system