KEGG   Alteromonas stellipolaris LMG 21861: AVL57_16820Help
Entry
AVL57_16820       CDS       T04545                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq00640  Propanoate metabolism
asq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AVL57_16820
Enzymes [BR:asq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     AVL57_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AMJ76499
Position
3641610..3644201
Genome map
AA seq 863 aa AA seqDB search
MNYEYRKPLPGAGIDFFDTREAVEAIEPGAYDKLPYTSRVFAENLVRRCNPDALTESLKQ
FIYRKNDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAKVNPVVPTQLIVDH
SLAVEHAGFEPDAFEKNRAIEDRRNDDRFHFIDWTKLAFKNVDVIPPGNGIMHQINLERM
SPVIQSRDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRLPDIVGV
ELTGKPQPNITATDIVLALTEFLRKERVVSSYLEFYGEGTTHLTLGDRATISNMTPEYGA
TAAMFYIDQQTIDYLRLTGREEKQIALVEQYAKHTGLWADSLASAEYERVLTFDLSSVGR
NMAGPSNPHARLATSDLAQRGVASAWEQEEGKMPDGAVIIAAITSCTNTSNPRNVIAAGL
IARNANQRGLTRKPWVKSSLAPGSKAVKLYLEEADLMGELEQLGFGVVAFACTTCNGMSG
ALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTVRFDIE
KDVLGIDNDGNPVTLKDIWPSDEEIDAIVAKSVKPEHFRKVYEPMFDLKVNTGSDISPLY
DWREMSTYIRRPPYWEGAMDAERTMTGMRPLAILGDNITTDHLSPSNAIMAASAAGEYLA
KMGLPEEDFNSYATHRGDHLTALRATLANPKVFNEMVLENGEVKQGSLARIEPEGKVVRM
WEAIEAYMQRRQPLIIVAGADYGQGSSRDWAAKGVRLAGVEVIAAEGFERIHRTNLLGMG
VLPLEFKPGTTRKTLELDGTETYDVKGEPAPGATLTLVVNRTNGETLDVPVTCRLDTAEE
VSIYSAGGVLQRFAKDFLEAEAT
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaataccgtaaacctctgcctggcgcaggaatcgattttttcgatacccgc
gaggcagtggaagccattgaacctggcgcctacgacaaacttccctacacttctcgtgtg
tttgctgaaaacttagtgcgccgttgtaacccagacgcactaacagagtcactcaagcag
tttatttaccgcaagaacgacttagattttccgtggtttcctgcccgggtggtatgccac
gatattttagggcaaaccgcgttagtcgacttagctggtttacgggatgccattgccgca
aaaggcggcgatccggcgaaagtaaatcctgtagtgcctacccagttaattgtcgatcac
tcattagccgttgaacatgcgggttttgaacccgacgcgtttgaaaaaaaccgcgctatt
gaagacagacgtaacgacgaccgttttcattttatcgactggactaaattagcgtttaaa
aacgtggatgtgataccgccaggtaacggcatcatgcaccaaatcaatttagagcggatg
tcgccggttattcagtctcgcgatggtgtagcctttcctgataccttggttggcaccgac
agtcacaccccgcatgttgatgcgctaggcgttattgctattggtgtgggcggccttgaa
gcggaaagcgttatgctagggcgcgcctcttacatgcgcctacccgatatagtgggtgtc
gagcttacgggtaaaccacagccaaatattacggctaccgatattgtacttgcccttacc
gagtttttacgtaaagagcgcgtggtgtcttcttatttggaattttatggcgagggaacc
actcacctcacccttggcgaccgcgccactatttcaaacatgacacccgaatatggcgct
accgcggccatgttctacatcgaccaacaaactatcgattatttgcgtttaacaggccga
gaagaaaagcaaattgcgttagttgaacagtatgccaaacacactggtttatgggcagat
tcattagcgagtgccgaatacgagcgtgttcttacctttgatttatcatcagttggccgc
aacatggctggcccatcgaatccacatgctcgtttagccaccagcgatttggcacagcgc
ggtgtcgccagcgcatgggaacaagaagaaggcaaaatgcctgatggcgcagtaattatt
gctgccattaccagttgtaccaatacatcaaaccctcgcaatgtaattgcagcaggctta
attgcccgcaatgcaaaccagcgtggtttaacccgcaaaccttgggtgaaaagttcatta
gcccctggatctaaagcagtaaaactgtatttagaagaggccgatttaatgggcgaacta
gaacagttaggctttggtgtagtggcctttgcctgtacaacgtgtaacggtatgagcggc
gcgctagaccctaaaattcagcaagaaattatagaccgagacttatacgccacagcggta
ctttctggtaaccgtaacttcgatggtcgtattcacccatatgcgaaacaagcctttttg
gcctcaccgccattagtggtggcgtacgctattgcgggcactgtccgttttgatattgaa
aaagacgtgttaggtattgataacgacggtaacccggtcacgcttaaagatatttggcca
agcgatgaagagattgatgccattgtcgcgaaaagcgtgaaaccagagcattttcgtaaa
gtgtacgagcctatgttcgacttaaaagtgaatactggcagcgacattagcccgctatac
gattggcgtgaaatgagcacctatattcgccgcccaccttattgggaaggcgcgatggat
gctgaacgtaccatgacgggcatgcgtccgctggctatattgggcgataacattactacc
gatcatttgtcgccctctaacgcgattatggcggcgagtgcggcaggtgagtatttggcg
aaaatgggattgccagaagaggactttaactcttatgccacccacaggggcgatcattta
acggcgcttcgcgccacccttgcgaacccgaaagtgttcaacgagatggtgcttgaaaat
ggcgaagtgaagcaaggttcgctggctcgcattgagcctgaaggcaaagtggttcgcatg
tgggaagccattgaagcctatatgcagcgcagacagccactaattattgtggcgggcgcc
gactatggtcagggttcttcacgtgattgggctgctaaaggtgtacgcctagctggggta
gaagtaattgcagcggaaggcttcgagcgcattcaccggaccaacttgcttggcatgggt
gtattaccccttgagtttaaaccgggcacaacccgtaaaacgcttgagcttgatggtact
gaaacctacgacgttaaaggcgaacctgcaccgggtgcaacattaaccttggtggtaaat
cgtactaatggtgaaaccctcgacgtaccggtaacttgccgtttagataccgctgaagag
gtatcgatttacagcgcaggcggtgtacttcagcgttttgccaaagacttcttagaagct
gaagctacttag

DBGET integrated database retrieval system