KEGG   Aeromonas schubertii: WL1483_1392Help
Entry
WL1483_1392       CDS       T04186                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
asr  Aeromonas schubertii
Pathway
asr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WL1483_1392 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:asr02022]
    WL1483_1392 (ompR)
Two-component system [BR:asr02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   WL1483_1392 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C WYL
Motif
Other DBs
NCBI-ProteinID: ALP40811
UniProt: A0A0S2SGI4
Position
complement(4150319..4151038)
Genome map
AA seq 239 aa AA seqDB search
MTQQQKVLVVDDDPKLRALLERYLSEQGFWVRGVANGEQADRLLTRENFHLIVLDLMLPG
EDGLSICRRLREGGNQIPILMLTAKGDEVDRIVGLEMGADDYLPKPFNPRELLARIRAVM
RRHSVELPGAPSATEKVVEFGAHVLNLATREMTTDGEPVTLTSGEFAVLKVLVSHPREAL
SRDKLMNLARGREYTATERSIDVQVSRLRRMLEADPAHPRYIQTVWGIGYVFVPDGATP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacagcaaaaggtgctggttgtcgatgatgatcccaagctgagagccctgctg
gaacgctatctgagcgagcaggggttctgggtgcgcggggtggcgaacggggagcaggcg
gataggctgctgacccgggagaactttcatctgatcgtgctggacctgatgctgcccggg
gaggatggcctatccatctgccgccgcctgcgtgagggggggaaccagatcccgatcctg
atgctgaccgccaagggggacgaggtggatcgcatcgtcggtctcgagatgggggccgac
gactacctgcccaagcccttcaacccccgcgagctgctggcccggatccgtgccgtgatg
cgccgtcactcggtggagctgccgggcgccccctccgccaccgagaaggtggtggagttc
ggtgcccacgtgcttaacctggcgacccgtgagatgaccacggatggcgagccggtcacc
ctgaccagcggcgagttcgccgtgctcaaggtgctggtcagccatccgcgcgaggccctg
tcgcgcgacaagctgatgaatctggctcgtggtcgcgagtacaccgccaccgagcgcagc
atcgacgtgcaggtgtcgcgcctgcgccgtatgctcgaggccgatccggcccatcctcgc
tatatccagaccgtctggggtatcggttatgtcttcgtgcctgacggcgcgacaccatga

DBGET integrated database retrieval system