KEGG   Aeromonas schubertii: WL1483_142
Entry
WL1483_142        CDS       T04186                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
asr  Aeromonas schubertii
Pathway
asr00230  Purine metabolism
asr01100  Metabolic pathways
asr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WL1483_142 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ALP39561
UniProt: A0A0S2SCU9
Position
2979227..2979712
AA seq 161 aa
MHPQTCAQLDIECEINGKPYRYSVPPSLSLLHLLRSQGLISVKEGCSVGECGACTVRVDG
VAIDSCIYLAVWANGKSIRTVEGEEKDGELSPLQQALIDEGAVQCGFCTPGLVMAGAALL
DKTARRPLTEEEIRRGLAGNLCRCTGYQNVVRAVQRCCHKK
NT seq 486 nt   +upstreamnt  +downstreamnt
atgcatccacaaacctgtgcccagctcgatatcgagtgcgagatcaacggcaaaccctac
cgctattcggtgccccccagcctctccttgctccacctgctgcgctcccaggggcttatc
agcgtcaaggaggggtgcagcgtcggcgagtgcggcgcctgcacggtgcgggtcgacggg
gtcgccatcgacagctgcatctacctggcggtgtgggccaacggcaagtccattcgcacc
gtggagggggaggagaaggacggggagctctcgcccctgcaacaggccctcattgacgag
ggggccgtgcagtgcggcttctgcacaccgggtctggtgatggccggggccgccctgctc
gacaagaccgcccgccgccccctgaccgaggaggagatccgccgaggtctcgccggtaac
ctctgccgctgcaccggctaccagaatgtggtgcgtgcggtgcagcgctgctgtcacaaa
aaatga

DBGET integrated database retrieval system