KEGG   Aeromonas schubertii: WL1483_3263
Entry
WL1483_3263       CDS       T04186                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
asr  Aeromonas schubertii
Pathway
asr00230  Purine metabolism
asr01100  Metabolic pathways
asr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WL1483_3263 (xdhA)
Enzymes [BR:asr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     WL1483_3263 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ALP42682
UniProt: A0A0S2SLS0
Position
2976059..2978356
AA seq 765 aa
MSIGLPFRRVDAQAKVTGRARYTDDFTMLGMRHAKYVRSTLAHGRVTAIDCSEALALQGV
EAVFTWQDVPDICYRTAGHAWNLDESKRDVKDRRLLTDHVRHYGDGVAIVVARDPLTAEK
GAALVRVTYEPLPVMTDAHSALAEGAEPIHPGGNLLRQSQIRGGEPEQAIEGAPFRCQGH
YETPVVQHCHLESVTCYAYMEQPGHLVVVSSTQIPQIVRSRVAKSLGLPWANVRVVKPYV
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFLASRTRHGFHIDGELGMDQDGR
LLGYRLDVLSNTGAYASHGHSIACAGANKISYLYPRSAFGYDARTFYSNLPTAGAMRGYG
APQVVFALECMMDDACTALGLDPLAVRLANVAREGDVNPVNRKTIYSAGLPECLRRGREL
FEWDRRRAECQSQTGRVRRGVGVACFSYGSNTYPVGVEIAGARMLLNQDGSVNLQIGATE
IGQGSDTVFAQMAAQTLGVPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHEAALQ
LKARILALASQLCHQEVGSLTLIDGYVVLAGAPDKVLMSVAEVSQNAYYHLSIGGQITSE
VSHKTTTNPPSFGCTFVDLSVDLDLCKVTINRIMNLHDAGQILNPVLAEGQVHGGMGMGI
GWALFEEMIIDPKSGVVRNPNLLDYKFPTITDLPPLECDFVQTYEPQSVYGHKSLGEPPI
ISPAPAIRNAILMATGVAINTLPITPKSLYRAFVRAALIEEAPHV
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgtccataggattaccctttcggcgcgtcgacgcccaggccaaggtgacggggagggcg
cgctataccgacgacttcaccatgcttggcatgcgccacgccaagtatgtgcgaagcacc
ctggcccacggccgggtgaccgccatcgactgcagcgaggccctggccctgcagggggtg
gaggcggtcttcacctggcaggatgtgcccgacatctgttatcgcaccgccggccacgcc
tggaatctcgacgagagcaagcgcgacgtgaaagaccgccgcctgctcaccgaccatgtg
cgccactacggggacggggtcgccatcgtggtggcccgcgatcccctcaccgccgagaag
ggggcggccctggtcagggtgacctatgagccgctgccggtgatgaccgatgcccacagc
gccctggccgagggggccgagcccatccatccggggggcaacctgctgcgccagagtcag
atccgcggcggcgagcctgagcaggccatcgagggggccccgtttcgctgccagggccac
tacgaaaccccggtggtgcagcactgccacctggagtcggtcacctgttatgcctacatg
gagcagccgggccacctggtggtggtctcgagcacccagatcccccagatagtgcgcagt
cgggttgccaagtccctgggcctgccctgggccaacgtgcgggtggtcaaaccctatgtg
gggggcggctttggcaacaagcaggatgtgctggaagagccgatggcggcgtttttgagc
tacaagctcgggggcgtgccggtcaaggtcaccctgagccgtgaggagtgcttcctcgcc
tcgcgcacccgccacggctttcatattgacggcgagctcggcatggaccaggacggccgc
ctgcttggctaccggctggatgtgctctccaacaccggggcctatgcctcccacggccac
tccatcgcctgcgccggggccaacaagataagttacctctatccgcgcagcgcctttggc
tatgacgcccgcaccttctacagcaacctgcccaccgccggggccatgcgtggctatggg
gcgccccaggtggtgttcgccctcgagtgcatgatggacgacgcctgcaccgccctcggg
ctcgatcccctggcggtgcgcctggccaacgtggcgcgcgagggggacgtcaacccggtc
aaccggaagaccatctacagcgccgggctgcccgagtgtctgcgccgggggcgcgagctc
ttcgagtgggacaggcgccgtgccgagtgccagagccagaccgggcgggtgcgccgcggg
gtgggggtcgcctgctttagttatggatccaacacctatccggtgggggtggagatagcg
ggcgcgcgcatgctgctcaaccaggatggctcggtcaacctgcagatcggcgccaccgag
atagggcagggctcggataccgtcttcgcccagatggcggcgcagaccttaggggtcccc
ttcgagcagatccgggtcatctcgacccaggacaccgacatcaccgcctatgaccccggc
tcgtttgcctcgcgccagagctatgtggccgcccccgccatccacgaggcggcgcttcag
ctcaaggcgcgcatcctggcgctcgcttcccagctctgccatcaggaggtggggtcgctg
accctcatcgacggctatgtggtgctggccggggcgccggacaaggtgctgatgagcgtg
gccgaggtgtcgcaaaacgcctattaccacctctccatcggtggccagatcacctcggaa
gtctcccacaagaccaccaccaacccgccgagctttggctgcaccttcgtcgatctcagc
gtcgatctggacctttgcaaggtcaccattaaccgcatcatgaacctgcatgacgccggt
caaatcctgaaccctgtgctggccgaggggcaggtgcacgggggcatggggatgggcata
ggctgggccctgtttgaggagatgatcatcgaccccaagagcggcgtggtgcgaaacccc
aacctgctcgactacaagttccccaccatcacggacttgccgccgctcgagtgcgacttc
gtgcagacctatgagccccagtccgtctatggccacaagtccctcggcgagccccccatc
atctcgccggccccggccattcgtaacgccatcctgatggcgaccggggtggccatcaac
accttgcccattacccccaagagcctctaccgggcgtttgtccgcgccgctctgattgag
gaggctccccatgtttga

DBGET integrated database retrieval system