KEGG   Aeromonas schubertii: WL1483_3780Help
Entry
WL1483_3780       CDS       T04186                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
asr  Aeromonas schubertii
Pathway
asr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:asr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WL1483_3780 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asr01007]
    WL1483_3780 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asr03016]
    WL1483_3780 (argS)
   03029 Mitochondrial biogenesis [BR:asr03029]
    WL1483_3780 (argS)
Enzymes [BR:asr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     WL1483_3780 (argS)
Amino acid related enzymes [BR:asr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   WL1483_3780 (argS)
Transfer RNA biogenesis [BR:asr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WL1483_3780 (argS)
 Prokaryotic Type
   Other AARSs
    WL1483_3780 (argS)
Mitochondrial biogenesis [BR:asr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WL1483_3780 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-ProteinID: ALP43199
UniProt: A0A0S2SN88
Position
4178937..4180682
Genome map
AA seq 581 aa AA seqDB search
MKEHIHHLLEQTVANLKSAGLLPADLEARIQVDRCKEKAHGDLATNLAMLLAKPAGKNPR
ELAAAIIEHLPASSQVAKVEIAGPGFINFFFDKAWLAGQIEAINASPKANVKLPAPQRVV
VDYSAPNVAKEMAVHHIRSTVLGDVAVRALEFLGHDVVRANHIGDWGTQFGMLIAYLEKM
ENEHASDMELRDLEAFYTQAKRYYDEDEAFAERARAYVVKLQSGDEYCRTMWKKLVDMTM
EQNQRNYDRLNVSLTNKDIMGESMYNDMLPTIAEDLKARGLAVEDDGALVVYLDEYKNKD
GEPMGVIIQKRDGGFLYTTTDIACAKYRYETLKADRVMYFIDSRQHQHLMQAWTITRNAG
YVPESVPLEHHAFGMMLGKDGRPYKTRSGGTVKLVDLLNEAEERATALLESRSSDIQGEE
RAKVINAIAMGAVKYADLSKNRTTDYVFDWDLMLSFEGNTAPYLQYAYTRIQSIFRKAEV
DPATLTGTITLTEDAEETLAQKLIQFSDAVNGVADKGMPHLLCTYLYELSGNFMTFYEAC
PINKDGVDEATRQSRLLLCATTAKVLKLGLDVLGIHTLERM
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcatattcatcatctacttgaacagacggttgccaacctgaaatccgccggt
ctgctgccggccgacctggaggcccgtattcaagtcgatcgatgcaaggagaaggctcac
ggcgacctggccaccaacctggcgatgctgctggccaagccggccggcaagaacccccgt
gagctggccgcggccatcatcgagcacctgcccgcctccagccaggtggccaaggtagag
attgccggccccggcttcatcaacttcttcttcgacaaggcttggctggccggccagatc
gaggccatcaacgccagccccaaggccaacgtgaagctgccggcaccccagcgcgtggtg
gtcgactactcggccccgaacgtcgccaaagagatggcggtgcaccacattcgctccacc
gtcctcggtgacgtggcggtgcgcgccctggagtttctcggccacgacgtggtgcgcgcc
aaccacatcggcgactggggcacccagttcggcatgctgatcgcctatctggagaagatg
gagaacgagcacgcctccgacatggagctgcgcgatctggaagccttctacacccaggcc
aagcgctactacgacgaagacgaagccttcgccgagcgcgcccgcgcctatgtggtgaaa
ctgcagagtggcgatgagtactgccgtaccatgtggaagaagctggtcgacatgaccatg
gagcagaaccagcgcaactacgatcgcctgaacgtctccctgaccaacaaggacatcatg
ggcgagtccatgtacaacgacatgctccccaccatcgccgaggatctgaaggcgcgcggc
ctggcggtcgaggatgacggtgccctggtggtctacctggacgagtacaagaacaaggat
ggcgagcccatgggggtcatcatccagaagcgtgacggtggcttcctctacaccaccacc
gacatcgcctgcgccaagtaccgctatgaaaccctcaaggcagaccgggtcatgtacttc
atcgactcccgtcagcaccagcacctgatgcaggcctggaccatcacccgcaacgccggc
tatgtgcccgagtccgtgcccctcgagcaccacgccttcggcatgatgctgggcaaggat
ggccgtccctacaagacccgttccggcggcaccgtcaagctggtcgacctgctcaacgaa
gccgaggagcgcgccaccgccctgctcgagagccgcagcagcgacatccagggtgaggag
cgcgccaaggtgatcaacgccatcgccatgggcgcggtgaagtacgcggatctctccaag
aaccgcactaccgactatgtgttcgactgggatctgatgctgtcgtttgagggcaacacc
gccccctatctgcagtatgcctatacccgtatccagtccatcttccgcaaggccgaggtg
gatccggcgaccctgaccggcaccatcaccctgaccgaagacgccgaagagaccctggcc
cagaagctgatccagttctccgacgcggtcaacggcgtggccgacaaggggatgccgcac
ctgctctgtacctatctgtacgagctctctggcaacttcatgaccttctacgaagcctgc
ccgatcaacaaggacggggtggacgaggcaacccgtcagagccgcctgttgctctgtgcc
accaccgccaaggtgctcaagctgggtctggacgtactgggcattcacaccctggagcgc
atgtaa

DBGET integrated database retrieval system