KEGG   Aeromonas schubertii: WL1483_4713Help
Entry
WL1483_4713       CDS       T04186                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asr  Aeromonas schubertii
Pathway
asr00071  Fatty acid degradation
asr00072  Synthesis and degradation of ketone bodies
asr00280  Valine, leucine and isoleucine degradation
asr00310  Lysine degradation
asr00362  Benzoate degradation
asr00380  Tryptophan metabolism
asr00620  Pyruvate metabolism
asr00630  Glyoxylate and dicarboxylate metabolism
asr00640  Propanoate metabolism
asr00650  Butanoate metabolism
asr00900  Terpenoid backbone biosynthesis
asr01100  Metabolic pathways
asr01110  Biosynthesis of secondary metabolites
asr01120  Microbial metabolism in diverse environments
asr01130  Biosynthesis of antibiotics
asr01200  Carbon metabolism
asr01212  Fatty acid metabolism
asr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WL1483_4713
   00630 Glyoxylate and dicarboxylate metabolism
    WL1483_4713
   00640 Propanoate metabolism
    WL1483_4713
   00650 Butanoate metabolism
    WL1483_4713
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WL1483_4713
   00072 Synthesis and degradation of ketone bodies
    WL1483_4713
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WL1483_4713
   00310 Lysine degradation
    WL1483_4713
   00380 Tryptophan metabolism
    WL1483_4713
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WL1483_4713
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WL1483_4713
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WL1483_4713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asr04147]
    WL1483_4713
Enzymes [BR:asr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WL1483_4713
Exosome [BR:asr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WL1483_4713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALP41860
UniProt: A0A0S2SJG7
Position
complement(2310709..2311875)
Genome map
AA seq 388 aa AA seqDB search
MEVVIVAARRTPMGSFMGALSPLAAPVLGARVVQALLAQCGLAGDEVEELYAGNVLSAGL
GQAPARQMALLGGLAERVPCTTINKVCGSGMKSVMVAADQIRLGQSKVVLAGGMESMSRA
PYLIDKARSGLRMGHQTLLDHLFLDGLQDAYEGHLMGHYAQKVADEQGIGRAEMDEYAIA
SLSRARRAIEEGAFVSEWVSVVDNKGMSLLEVDEQPGKARPEKIPHLKPAFGEGGSITAA
NASSISDGAAGLLLMSRDEAQRRGLPILAKICGYSTHAAAPAGFTTAPVGAMVRLLEQLG
WHSREVDLFEINEAFAMVPMLAMKAMDLSHDRVNIHGGACALGHPLGASGARILVTLIHA
MHRLGARRGMASLCIGGGEATALALELP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggtgatcgttgccgcccgtcggacaccgatgggcagttttatgggggcattg
tcgccgctcgcggcgcctgtgctgggcgcaagggtggtacaggcgctgctcgcccagtgc
gggctggcgggggatgaggtggaagagctctatgccgggaacgtgctctcggcggggttg
gggcaggcgcctgcccgtcagatggccctgttgggcggattggcggagcgggtcccatgt
accacgatcaacaaggtgtgtggctcagggatgaagagcgtcatggtggcggccgatcag
atccgcctcgggcagagcaaggtggtgctggccggtggcatggagagcatgagccgtgct
ccctatctcatcgacaaggcgcgatcaggcctgcgcatgggccatcagacgttgctcgat
catctcttcctagacggtttgcaggatgcctatgagggtcacctgatggggcactatgcc
cagaaagtggccgatgagcagggcatcgggcgcgccgagatggatgagtatgccatcgcc
tctctgtcacgggctcgccgggccatcgaagagggcgcgtttgtttccgagtgggtgagt
gtcgtcgataacaaagggatgagcctgctcgaggtggacgagcagccgggtaaagccagg
cccgagaagatccctcatctcaaaccggcgtttggagagggcggatcgatcacggcggcc
aacgccagctcaatctcggatggcgccgcagggctactgctcatgagccgggatgaggcg
cagcgccgcgggttgccaatcctggcgaagatctgtggctacagcactcatgcggccgca
cctgccggctttacgacggcccccgttggtgccatggtcaggctgctcgagcagctgggg
tggcacagccgcgaggtggatctgttcgaaatcaatgaagccttcgccatggtgcctatg
ctggccatgaaagccatggatctctcccatgacagggtcaacatacatggcggtgcatgc
gccctcggtcatcctctgggggcgagcggagcgaggatcctggtgaccctgatccacgcc
atgcaccgtcttggggcgcgtcgtggtatggcatccctctgcattggtggcggggaggcc
acggcgttggcattggagcttccttag

DBGET integrated database retrieval system