KEGG   Aeromonas schubertii: WL1483_4958Help
Entry
WL1483_4958       CDS       T04186                                 

Gene name
nlp2
Definition
(GenBank) carbon-nitrogen family hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
asr  Aeromonas schubertii
Brite
KEGG Orthology (KO) [BR:asr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WL1483_4958 (nlp2)
Enzymes [BR:asr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     WL1483_4958 (nlp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ALP43301
UniProt: A0A0S2SNI6
Position
complement(3627235..3628077)
Genome map
AA seq 280 aa AA seqDB search
MWLSALQLVSGRHWPANRELIAALLAELPAERPLLALLPENFALFGERQGYLDGAESLGE
GPIQAQLAEWAREHNIWLVAGAMPTRIEGEARIHTSSLVFDPEGICQGVYHKLHLFDVDV
ADSQGRYRESETFSPGEHPVTVPSPLGTLGLSICYDLRFPELYRTLVAAGARILLVPAAF
TRFTGAAHWETLLRARAIENQCWVVAANQGGDHETGRETFGHSMIVDPWGTVVACKGEGA
GVVSARFDPQQASLLGERMPVLRHARLMNMNAEHGDGERD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtggttatctgccctgcaactggtctctggccgccactggcctgctaaccgcgagctc
atagcggctctgctggccgagctgccggccgagcgcccactgctggccctgctgccggag
aacttcgccctgtttggtgagcgccagggttacctcgacggcgcagagtccctcggcgag
gggccgattcaggcacagctggccgagtgggcccgcgagcacaatatctggctggtagcc
ggcgccatgccaacccgcatcgagggggaggcgcggatccacaccagctcgctggtgttt
gatcccgaagggatatgccagggggtttatcacaagctgcacctgttcgatgtggatgtg
gccgacagccaggggcgctaccgggagtccgagaccttcagtccgggtgagcacccggtc
accgtgccctcgccgctggggacgctggggctctccatctgttatgatctgcgctttccc
gagctataccgcaccctggtcgccgccggggcccgcatcctgttggtgccggctgccttc
actcgcttcaccggcgccgcccactgggagaccctgctaagggcccgcgccatcgagaat
caatgctgggtggtggccgccaatcaggggggcgatcacgaaaccggccgcgagaccttc
ggccacagcatgatcgtcgatccctggggaactgtggtcgcctgcaagggcgagggtgca
ggtgtagtgagtgcccgcttcgacccgcagcaggcaagcctgctgggtgagcgcatgccg
gtactgcgccacgcccgtctgatgaacatgaacgccgaacacggcgatggagaacgagat
tga

DBGET integrated database retrieval system