KEGG   Actinobacillus suis ATCC 33415: ASU1_00585Help
Entry
ASU1_00585        CDS       T03246                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ass  Actinobacillus suis ATCC 33415
Pathway
ass00010  Glycolysis / Gluconeogenesis
ass00030  Pentose phosphate pathway
ass00051  Fructose and mannose metabolism
ass00680  Methane metabolism
ass01100  Metabolic pathways
ass01110  Biosynthesis of secondary metabolites
ass01120  Microbial metabolism in diverse environments
ass01130  Biosynthesis of antibiotics
ass01200  Carbon metabolism
ass01230  Biosynthesis of amino acids
Module
ass_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU1_00585
   00030 Pentose phosphate pathway
    ASU1_00585
   00051 Fructose and mannose metabolism
    ASU1_00585
  09102 Energy metabolism
   00680 Methane metabolism
    ASU1_00585
Enzymes [BR:ass01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ASU1_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AIJ30394
Position
116292..117368
Genome map
AA seq 358 aa AA seqDB search
MALLDIVKPGVVTGDDVQKVFAYAKANNFAIPAVNCVGSDSVNAVLETAARVKAPVIVQF
SNGGAQFYAGKGIKPASGARADVLGAIAGAKHVHALAEEYGVPVILHTDHAAKKLLPWID
GLLDAGEKHFAETGKPLFSSHMIDLSEEPMEENMAICREYLARMDKMGMTLEIEIGITGG
EEDGVDNSDVEESKLYTQPEDVLYVYDQLNPVSPRFTVAAAFGNVHGVYKPGNVKLKPSI
LGASQEFVSKERNLPAKSIDFVFHGGSGSSREEIREAISYGAIKMNIDTDTQWASWDGIL
QFYKANEAYLQGQLGNPEGPDSPNKKYYDPRVWLRKMEESMSKRLEQSFEDLNCVNVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcattattagacatcgtaaaaccgggtgtagtaacaggcgacgacgttcaaaaagta
ttcgcttatgctaaagcaaacaattttgcaattccggcggtaaactgtgtaggttctgac
tctgtaaatgcagtattagaaacagcagcgcgtgtaaaagcacccgttatcgttcagttc
tctaacggtggtgcacaattctatgcaggtaaaggtatcaaaccagcatcaggtgctcgt
gcagatgttttaggtgcaatcgcaggtgcgaaacacgttcacgcgttagcagaagagtac
ggtgtaccggtaattcttcatactgaccacgctgcgaaaaaattacttccatggattgac
ggtttattagatgcgggtgaaaaacactttgcggaaacaggtaaacctttattctcttct
cacatgatcgacctttcagaagagccaatggaagaaaacatggcaatctgccgtgagtac
ttagctcgtatggataaaatgggtatgacacttgaaattgaaatcggtattaccggtggt
gaagaagatggtgttgacaactcagatgttgaagagtctaaattatatactcaaccggaa
gatgttttatacgtttacgaccaattaaacccagtaagcccacgtttcactgttgccgct
gcattcggtaacgtacacggtgtttacaaaccgggtaacgtaaaattaaaaccttcaatc
ttaggtgcatcacaagagttcgtttctaaagagcgtaaccttcctgcgaaatcaatcgac
ttcgtattccacggtggttctggttcatcacgtgaagaaatccgtgaagcgatcagctac
ggtgcgatcaaaatgaacatcgatacagatacgcaatgggcgtcttgggatggtattctt
caattctacaaagcgaacgaagcatacttacaaggtcaattaggtaaccctgaaggtcca
gattctccaaacaaaaaatactacgatccacgtgtttggttacgtaaaatggaagaatct
atgtctaaacgcttagaacaatctttcgaagatttaaactgtgtaaacgttttataa

DBGET integrated database retrieval system