KEGG   Actinobacillus suis ATCC 33415: ASU1_02695Help
Entry
ASU1_02695        CDS       T03246                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ass  Actinobacillus suis ATCC 33415
Pathway
ass00020  Citrate cycle (TCA cycle)
ass00310  Lysine degradation
ass00380  Tryptophan metabolism
ass01100  Metabolic pathways
ass01110  Biosynthesis of secondary metabolites
ass01120  Microbial metabolism in diverse environments
ass01130  Biosynthesis of antibiotics
ass01200  Carbon metabolism
Module
ass_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASU1_02695
  09105 Amino acid metabolism
   00310 Lysine degradation
    ASU1_02695
   00380 Tryptophan metabolism
    ASU1_02695
Enzymes [BR:ass01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ASU1_02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Hep_59
Motif
Other DBs
NCBI-ProteinID: AIJ30813
Position
complement(593151..594380)
Genome map
AA seq 409 aa AA seqDB search
MTIEILTPDLPESVADATVATWHKNVGDAIKRDEVIVEIETDKVVLEVPAPHDGILAEIC
QVQGATVISKQLLGKISTVQAGDFTQETIKPTNEATPADRKSAAIEHDHSDADSQGPAIR
RLLAEHNIEAHLVKGTGVGGRITREDIEHHLAQRQTQASKQAIDTEQSTVSTVSYSARSE
KRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMADIE
KTIKELAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPV
AINGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattttaacgccggacttacccgaatctgttgcagatgcgactgttgct
acttggcataagaatgtgggtgatgcaattaaacgtgatgaagtaatcgttgaaattgaa
acggataaagtcgtattagaagtaccagcgccgcatgacggtattttagcggaaatctgc
caagttcaaggcgctactgttatttccaaacaattactcggcaaaatctcaaccgtccaa
gcaggcgatttcacccaagaaacgattaaaccaacgaatgaagcgactccggcggatcgt
aagtctgcagctattgagcatgaccattccgatgcggattctcaaggcccagcgattcgc
cgtttattggctgaacacaatattgaggctcatttagtcaaaggtaccggtgttggcggc
agaattacccgtgaagatattgaacatcatttagcacaacgtcaaacacaagcttcaaaa
caggctattgacacagagcaaagcactgtcagtaccgtgtcttactcagcacgtagcgaa
aaacgtgtgccaatgacacgtttacgtaaacgtattgctgaacgtctgttagaagcgaaa
aatacaacggcaatgttaaccacattcaatgaagtggatatgcagccgattatgacatta
cgtaaaacttacggtgaaaaatttgaaaaacaacacggtgtacgtttaggctttatgtcg
ttctatattaaagcggttgttgaagcattaaaacgttatccggaaatcaatgcatcgatt
gacggtgatgatgtggtatatcacaactatttcgatattagtattgcggtctcaacccct
cgcggcttagtcacaccggttatccgtaactgcgataaattatcgatggcggatattgag
aaaacgattaaagagcttgctgaaaaaggtcgtgacggtaaattaaccgtagaagattta
accggcggtaattttaccattacaaacggtggtgtattcggttcattaatgtctaccccg
atcatcaatccaccacaaagtgcgattttagggatgcacgccattaaagatcgcccggtt
gccataaacggccaagtggttattcgtccaatgatgtatctagcactttcttatgaccat
cgtttaattgatggacgtgaatctgttggtttcttagttgctgtcaaagatttattagaa
gatccgacacgtttattacttgaaatttaa

DBGET integrated database retrieval system