KEGG   Actinobacillus suis ATCC 33415: ASU1_10915Help
Entry
ASU1_10915        CDS       T03246                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ass  Actinobacillus suis ATCC 33415
Pathway
ass00620  Pyruvate metabolism
ass01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASU1_10915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ass02000]
    ASU1_10915
Enzymes [BR:ass01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ASU1_10915
Transporters [BR:ass02000]
 Other transporters
  Primary active transporters [TC:3]
   ASU1_10915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Amidohydro_1 NQRA ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIJ32438
Position
complement(2399423..2401225)
Genome map
AA seq 600 aa AA seqDB search
MTIQNKKIAITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYWSLEAWGGATFDSCIR
FLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVDRFVERCVTNGMDVFRVF
DALNDPRNMQAALQAVKKHGGHAQGTLSYTTSPVHTLQTWLDVTEQLLEIGVDSLVIKDM
SGILTPMAAYELVSEIKKRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATESIVATLQGTPYDTGLNIPQLEKISAYFRDVRKKYAKFEGQLRGVDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLQEIPRVREDLGNIPLVTPTSQIVGTQAVMNVLMGE
RYKTIAKETAGILKGEYGRTPAPVNKALQERVLEGAAPITDRPANHIAPEIDKLVAEVTA
QAKEKGITLSENAIDDVLIVALFQQVGWKFLENRNNPAAFEPAPTAESAKPAQAAAPKAQ
PQSGPAVYTVELEGKAFVVKVSEGGDITNIAPTAPTAAPQVAAPAATSANAEPVKAPMAG
NILKVEVTEGQQVAEGDVLLILEAMKMETQICAPKAGKVQGIAAKQGDVVAVDQVLMNLA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgactattcaaaataaaaaaattgcaattactgatgttgttttacgtgatgcacaccaa
tctttgtttgcgacacgactacgtttagacgatatgctaccgattgcggctgaattagat
aaaatcggctattggtctttagaagcatggggcggtgcgacttttgatagctgtatccgt
tttttaggtgaagatccttgggtacgtttgcgtgagttgaaaaaagcgattccaaataca
ccactgcaaatgttattacgcggacaaaatttattaggctaccgtcattatgcggatgat
gtggtagatcgctttgtggaacgttgtgttaccaacgggatggatgtgttccgtgtgttt
gatgcgttaaatgaccctcgcaatatgcaagcggcattacaagcggtcaaaaaacacggt
gggcatgcacaaggtacgttaagttataccaccagtccggtacacaccttacaaacgtgg
ttagacgtaactgaacaattattagaaatcggagtagattctctcgttatcaaagatatg
tccggtattttaaccccaatggcggcttatgaattagtcagcgaaatcaaaaaacgttat
gacgtagaacttcacttacactgtcactcaaccaccggtatggcggaaatggcgttatta
aaagcgattgaagctggtgttgatggtgtagatacctctatttcttcaatgtccggtact
tatggtcatccggcaaccgaatccatcgtggcaacgcttcaaggtacgccttacgacacc
ggtttgaacattcctcaacttgaaaaaatctcagcttacttccgtgacgttcgtaaaaaa
tatgcgaagtttgaaggtcagttacgtggtgtagatagccgtattttagtggcacaagtg
ccgggcggtatgctaaccaaccttgaaagccagttaaaacaacaaaatgcaagtgacaaa
cttgatcttgtactacaagagatcccacgtgtacgcgaagatcttggtaatattccgctt
gttacgccaacctcacaaattgtcggtactcaagcggtaatgaacgtgttaatgggcgaa
cgctataaaactatcgctaaagaaaccgccggtattttaaaaggtgaatacggtcgtaca
cctgcaccggttaataaagcgttacaagaacgtgtacttgaaggtgctgcaccgattact
gatcgtccggcaaatcatattgcccctgaaatcgataaattggtagcggaagtaacggca
caggctaaagaaaaaggcattaccctctcagaaaatgcaattgatgacgtgctaatcgtg
gcgttattccaacaagttggttggaaattcctagaaaaccgtaataatccggctgccttt
gagccggcaccgacagcagaatcagctaaacctgctcaggcagcagcaccaaaagcacag
ccacaatcaggccccgcagtttatacggttgaacttgaaggcaaagcctttgtggtgaaa
gtcagtgaaggcggagatattaccaatattgcaccaacagccccaaccgctgcaccacaa
gttgcagctcctgcagcaaccagtgcaaatgctgaaccagtcaaagcaccgatggcaggt
aacattcttaaagttgaagtaaccgaaggtcaacaagttgcggaaggtgatgtgttatta
attcttgaagcaatgaaaatggaaactcaaatttgcgcaccaaaagccggtaaagtccaa
ggcattgcggcaaaacaaggtgatgtcgttgcagttgatcaagtattaatgaatctcgct
taa

DBGET integrated database retrieval system