KEGG   Actinobacillus succinogenes: Asuc_0357
Entry
Asuc_0357         CDS       T00558                                 
Name
(GenBank) Alanine racemase
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
asu  Actinobacillus succinogenes
Brite
KEGG Orthology (KO) [BR:asu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asu03000]
    Asuc_0357
Transcription factors [BR:asu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Asuc_0357
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 Peripla_BP_6 HTH_26 HTH_31 HTH_Tnp_ISL3 HTH_38 HTH_7 Crp HTH_24 HTH_IclR HTH_Crp_2 MarR CBP MarR_2 TetR_N
Other DBs
NCBI-ProteinID: ABR73735
UniProt: A6VL88
Structure
Position
404994..405977
AA seq 327 aa
MSIQDLARRAGVSVATVSRVLNNQPSVKPQNKEKVLAAIKELNYQPNLLARQLRTAKTGM
LLVMVSNIANPFCAAVVKGIEKTAEKNGYRILLCNTESDLARSRSCLTLLSGKMVDGVIT
MDALSELPELQNIIGAFPWVQCAEYDPLSTVSSVSIDDVAASEYVVDQLVKSGKKRIALI
NHDLAYQYAQHRESGYLNRLKFHGLDYSRISYAENLDYMAGKLATFSLLKSAVKPDAIFA
ISDVLAAGAIQALTESGLSIPQDVAVVGFDGVDISQITVPALTTVQQPSEQIGMKAVSLL
LEQIHSDVLAKTVHHLLPWKFVRRQSS
NT seq 984 nt   +upstreamnt  +downstreamnt
gtgtccattcaagatttggcgcgccgcgccggtgtttctgtcgcgacggtatcgagagtg
ttgaataatcaaccgtcggttaaaccgcaaaataaagaaaaggtgctggcggcgattaaa
gaactcaattatcagccgaatttgctggcgcgccagttaagaacggcaaaaacggggatg
ttgttggtgatggtttccaatattgccaatccgttttgcgccgccgtggtgaaaggtatc
gaaaaaacggcggaaaagaacggatatcggattttattgtgcaatacggaatccgattta
gcccgttcccgttcctgtttgacattattgtcgggcaaaatggtggatggtgtgattacc
atggacgctttgtccgaactgcccgaattgcagaatattatcggtgcgtttccttgggtt
cagtgtgcggaatacgatccgctttcgacggtttcttccgtcagtatcgatgatgtcgcc
gcctcggaatatgtggtggatcagttggttaaatccggtaaaaaacgtatcgctctgatt
aatcatgatcttgcttatcaatatgcccagcaccgtgaatcgggttatctcaatcggttg
aaatttcatgggctcgactattcccgcattagttatgcggaaaatttggattatatggcg
ggtaaactagcgacattttcgttgctgaaaagtgcggtcaaacctgatgcgatttttgcc
atttccgatgtgcttgccgcgggcgctattcaggcgttaacggaatcgggactgagtatt
ccgcaggatgtggcggtcgtgggatttgacggcgtggacatcagtcaaatcaccgtacct
gccttaaccaccgttcaacaacccagcgaacaaatcggtatgaaagccgtttcgttactg
ttggagcaaatccattccgatgttcttgcaaaaaccgttcatcatctattgccttggaaa
tttgtgcgacgacagtccagttaa

DBGET integrated database retrieval system