KEGG   Actinobacillus succinogenes: Asuc_0196
Entry
Asuc_0196         CDS       T00558                                 
Name
(GenBank) Monosaccharide-transporting ATPase
  KO
K10440  ribose transport system permease protein
Organism
asu  Actinobacillus succinogenes
Pathway
asu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:asu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Asuc_0196
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asu02000]
    Asuc_0196
Transporters [BR:asu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Asuc_0196
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: ABR73576
UniProt: A6VKS9
Position
232078..233046
AA seq 322 aa
MYTQNSFKLGKFLLEQRSIVALLVLIGIVSAINPDFFTIDNILNILRQTSVNAIIAVGMT
FVILIAGIDLSVGSVLALTGAIAASLVGSEFSMLLVIPAVLFIGAFLGGVSGVIVAKGKV
QAFIATLVTMTLLRGVTMVYTDGRPISTGFSDAADQFSYLGTGYLFGIPVPIWLMAVVFA
VAWYILKHTRIGRYIYALGGNEAATQLSGINVNKIKVFVFAVSGFLSALAGLIVTSRLSS
AQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALIIGFLNNALNLLDISSYYQMI
AKALVILAAVLADNYLGSKKHN
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtatacccaaaattcatttaaattaggaaaatttctgttagaacaacgttctatcgta
gcattgttggttttaatcgggattgtttcggcaattaatcccgacttcttcaccattgat
aatattctcaatattttacgccagacgtcggtaaatgcgattatcgccgtaggaatgact
tttgttattctgattgccggtattgatttatctgtaggttccgtattggcattaaccggt
gccattgccgcttcgttggtaggcagtgaattttcaatgctactggtaattcctgccgta
ttgtttattggcgcatttctcggcggcgtcagcggtgtcattgtagccaaagggaaagta
caggcatttatcgcaactttggtaacgatgacattattacggggcgtcaccatggtatac
accgacggacgtcctatcagcaccggtttttccgatgcagcggatcaattctcttatttg
ggaacaggttatttattcggtattcccgtacctatttggctgatggcggtagtctttgct
gtagcatggtacattttaaaacatacccgtattggtcgttatatctatgccttgggtggc
aatgaagcggcaactcagctttccggtattaatgtcaacaaaatcaaagtgtttgtattt
gccgtaagcggttttttatccgcacttgccgggttaattgtcacatctcgtctttcctct
gcacaaccgacagcaggcgtatcttacgaattggatgctattgccgctgttgtcgtgggc
ggaaccagtctgatgggcggtaaaggtcgggttatgggtacactaatcggtgcgctgatt
atcggatttttaaataatgcattgaatttattggatatttcatcttattatcaaatgatt
gccaaagcactcgttattttagctgctgtgcttgcggataattatttaggcagtaaaaag
cataattag

DBGET integrated database retrieval system