KEGG   Actinobacillus succinogenes: Asuc_0197
Entry
Asuc_0197         CDS       T00558                                 
Name
(GenBank) Monosaccharide-transporting ATPase
  KO
K10439  ribose transport system substrate-binding protein
Organism
asu  Actinobacillus succinogenes
Pathway
asu02010  ABC transporters
asu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Asuc_0197
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Asuc_0197
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asu02000]
    Asuc_0197
Transporters [BR:asu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Asuc_0197
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR SBP_bac_3 ANF_receptor
Other DBs
NCBI-ProteinID: ABR73577
UniProt: A6VKT0
Structure
Position
233066..233944
AA seq 292 aa
MKKLTTIASSFVLAFAVSGSVLAQETIALTVSTLDNPFFVSLKDGAQKKATELGYKLVVL
DSQNDPSKELSNVEDLTVRGAKVLLINPTDSAAVSNAVAIANRNKIPVITLDRGAAKGEV
VSHIASDNVAGGKMAGDFIAQKLGDGAKVIQLEGLAGTSAARERGEGFKQAIEAHKFDVL
ASQPADFDRTKGLNVTENLLASKGSVQAIFAQNDEMALGALRAISAAGKKVLVVGFDGTE
DGVKAVKSGKLAATVAQQPELIGSLGVETADKILKGEKVDAKIPVALKVVTE
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaaaaaactcacaaccatagcttcatctttcgtcttagcttttgccgttagtggttcg
gtgttagctcaggaaacaatagcattaaccgtatcaacattagataatccgttctttgtg
tcattaaaagacggcgcacaaaaaaaagcgacggaactaggttataaattggtagtccta
gacagccagaacgacccgtccaaagagctatctaacgtagaagatttaacggttcgtggc
gcaaaagtattgttgattaatccgaccgacagcgccgcggtcagcaatgcggtagcgatt
gccaaccgcaataaaattcctgttatcacattagaccgtggtgcagcaaaaggcgaagtg
gtcagtcatattgcctctgacaatgttgccggcggtaaaatggcgggggacttcatcgct
caaaaattaggtgacggcgcaaaagtaattcaattggaaggtttggcaggtacatctgct
gcccgtgaacgaggtgaaggttttaaacaagcaattgaagctcacaaatttgatgtatta
gccagtcaacctgctgactttgaccgaaccaaaggcttaaacgtaactgaaaatctattg
gcaagcaagggatcagtccaagcgatttttgcccaaaatgacgaaatggcgttaggtgcg
ttacgcgccatcagtgccgcagggaaaaaggtactggttgtcggtttcgatggtacagag
gacggtgttaaagcggttaaaagcggtaagttagcggcaacagtagcgcaacaaccagaa
ttaattggtagtctaggcgttgaaaccgccgataaaatcctaaaaggtgagaaagtcgat
gccaaaatcccggttgcattaaaagttgtaactgaataa

DBGET integrated database retrieval system