KEGG   Actinobacillus succinogenes: Asuc_0302Help
Entry
Asuc_0302         CDS       T00558                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00620  Pyruvate metabolism
asu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Asuc_0302
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asu02000]
    Asuc_0302
Enzymes [BR:asu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Asuc_0302
Transporters [BR:asu02000]
 Other transporters
  Primary active transporters [TC:3]
   Asuc_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABR73680
UniProt: A6VL33
Position
complement(340751..342559)
Genome map
AA seq 602 aa AA seqDB search
MAKKIKVTELVLRDAHQSLFATRLRLDDMLPIAAELDDIGYWSLEAWGGATFDSCIRFLG
EDPWVRLRELKKACPKTPLQMLLRGQNLLGYRHYADDVVERFVERCVANGMDVFRVFDAL
NDPRNMKAALQAVKKQGGHAQGTLSYTTSPVHTLQTWLDTTEQLLEIGVDSLVIKDMSGI
LNPMAAAELVGEIKKRFDIELHLHCHATTGMSEMALLKAIEAGVDGVDTAISSMSGTYGH
PATEAIVATLQGTAFDTGLDIPRLEKIAAYFRDVRKKYAKFEGQLRGVDSRILVAQVPGG
MLTNLENQLKQQNASDKLDKVLEEIPLVRKDLGYIPLVTPTSQIVGTQAVINVLMGERYK
TIAKETAGVLKGEYGKTPAPVNAELQARVLEGGEPMTDRPADHLEPEMANIEADVIAQAK
EKGVALSENSVDDALIVALFPQIAWKFLENRNNPAAFEPAPTAESAAEKPQEKAAPKAQS
GSAVYTVEVEGKAFVVKVSEGGDISAIAPATAPAAAAQAAPAAAPAPAPSAGGVQVTAPM
AGNIWKVIATEGQTVAEGDVLFILEAMKMETEVKAAQAGTVRNIQVKAGDSVSVGDVVMT
LA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaattaaagttaccgaattagtacttcgtgatgctcatcaatctcttttc
gcaacacgtttacgccttgacgatatgttgcctatcgcagcggaattagacgatatcggc
tactggtcattggaagcctggggcggtgcgacattcgatagctgtattcgttttttaggc
gaggacccttgggtacgtttgcgcgagctgaaaaaagcctgcccgaaaactccgttgcaa
atgttattgcgcggacaaaacttattaggctaccgtcattatgccgatgacgtggtggag
cgttttgttgaacgttgcgtggcaaacggtatggatgttttccgtgtatttgatgcgcta
aacgatccgcgaaatatgaaagccgcattacaagcagtgaaaaaacagggcggtcacgca
caaggtacattaagttataccaccagcccggttcacacattacaaacttggttagacact
actgaacaattattggaaatcggcgtggacagcctggttattaaagatatgtcaggcatt
ttaaacccaatggctgcggccgaacttgtaggcgaaatcaaaaaacgttttgatatcgaa
ttacatttacactgccacgctacgaccggtatgtccgaaatggcgttgctgaaagctatt
gaagcaggtgtcgacggggtagatacggcgatttcttcaatgtccggtacttacggtcat
ccggcaacggaagcgattgtggcaaccttgcaaggcacagcattcgataccggattagac
attcctcgtttggagaaaattgccgcctatttccgtgacgtacgtaaaaaatacgcaaaa
ttcgaaggtcagttacgtggtgtggacagccgtattttagtggcgcaagtgccgggcggt
atgttaaccaatcttgaaaatcaactcaaacaacaaaatgcgtcggataaactggacaaa
gtattagaagaaatcccactcgtgcgtaaagatttgggttatattccgttggttacaccg
acttcgcaaattgtaggtacacaagctgttattaacgtgttaatgggtgaacgttacaaa
accatcgccaaagaaaccgccggcgtattgaaaggcgaatacggtaaaactccggcaccg
gttaatgccgaattacaagcgcgtgtattagaaggtggggaaccgatgaccgaccgtcct
gcagatcaccttgaaccggaaatggctaacatcgaagcggacgttattgcacaagcaaaa
gaaaaaggtgtggctttatcagaaaattccgtagatgatgcgttaattgtggctttattc
ccgcaaattgcttggaaattcttggaaaaccgtaataatccggcagcctttgaaccggca
cctaccgcagaaagtgccgcggaaaaaccgcaggaaaaagcggcaccgaaagcccaatcc
ggttcggccgtctataccgttgaagtggaaggtaaagccttcgtagtgaaagtcagcgaa
ggcggtgatatttcggctatcgcaccggcaaccgctcctgctgcggctgcgcaagctgct
ccggccgcagcaccggctcccgcaccttcagcgggcggcgtgcaggttaccgcaccgatg
gcgggcaacatctggaaagtgattgcaaccgaaggtcaaactgttgcggaaggagacgtt
ctgtttattctcgaagcaatgaagatggaaaccgaagttaaagcggcgcaagccggtacg
gttcgcaatatccaagtgaaagcgggtgacagcgtatccgtcggcgacgttgtgatgacc
ttggcataa

DBGET integrated database retrieval system