KEGG   Actinobacillus succinogenes: Asuc_0403Help
Entry
Asuc_0403         CDS       T00558                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00071  Fatty acid degradation
asu00350  Tyrosine metabolism
asu00625  Chloroalkane and chloroalkene degradation
asu00626  Naphthalene degradation
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0403
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Asuc_0403
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Asuc_0403
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asuc_0403
   00626 Naphthalene degradation
    Asuc_0403
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Asuc_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 TetR_C_25
Motif
Other DBs
NCBI-ProteinID: ABR73781
UniProt: A6VLD4
Position
complement(455976..457133)
Genome map
AA seq 385 aa AA seqDB search
MSTYYFLPTRNVFGENAVEEVGTLMKSLGGNNPLIVTDAFLAKNGMADQLAAVLSNAGLK
PVIFGGAEPNPTDKNVEEGIVFYNEHGCDSIISLGGGSSHDCAKGIGLIASNGGRIQDYE
GVDRSHNAMVPLMAVNTTAGTASEITRFCIITDTARKVKMAIVDWRITPQIAVNDPLLMK
GMPPSLTAATGMDALTHAIEAYVSTAANPLTDAAALMAITMIQQYLPKAVANGDYMKARD
KMAYAQYLAGIAFNNASLGYVHAMAHQLGGFYNLPHGVCNAILLPYVEEFNLIGNLNRFR
DIAKAMGENIDGLCTDDAALKAIGAIRRLSKQVGIPANLQLLGVKPEDFDVMAENAMKDV
CMLTNPRKATKQQVIEIFQRAYDGD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatattattttttaccaaccagaaatgtattcggcgaaaatgcagttgaagaa
gtcggcacattaatgaaaagtttaggcggcaacaatcctctgattgttaccgatgctttc
ctcgccaaaaacggtatggcggatcaattagccgccgtattaagtaacgcaggtttaaaa
ccggtgattttcggcggtgccgaaccgaatccgacagacaaaaacgtagaagagggtatt
gtgttttataacgaacacggttgcgattccatcatttctttgggcggtggttcctcccac
gactgtgccaaaggtatcggtttaatcgccagtaacggcggacgcattcaggattacgaa
ggcgtcgatcgttcccacaatgcgatggtaccgctgatggcggtcaacaccacggcggga
acggcgtctgaaatcacccggttctgtattattaccgacacggcgcggaaagtgaaaatg
gcgattgtagactggcgcatcactccgcaaatcgcggtgaacgatccattgttgatgaaa
ggcatgccgccaagcctgaccgcagcaaccggtatggacgccctgacgcacgcaatcgaa
gcctacgtatccactgccgccaacccgctcacggatgccgcagcgctgatggcgatcacc
atgattcagcaatacctgccgaaagcggtagcgaacggcgactatatgaaagcccgcgat
aaaatggcatatgcgcaatatttggcaggtatcgctttcaataatgcctctctcggctat
gttcatgcgatggcacaccaactgggcggtttctacaacctgccgcacggtgtgtgtaac
gcgattctgttgccttatgtggaagaattcaacctcatcggtaatctcaaccgtttccgc
gacatcgccaaagctatgggtgaaaatatcgacggtttatgcacggacgatgcggcactg
aaagccattggcgcgattcgccgtttaagcaaacaagtgggaatcccggcaaatctgcaa
ctgctcggcgtgaaaccggaagatttcgacgtgatggcggaaaatgcgatgaaagacgtg
tgtatgctcaccaatccgcgcaaagccaccaaacagcaagtcatcgaaattttccaacgg
gcttatgacggcgattaa

DBGET integrated database retrieval system