KEGG   Actinobacillus succinogenes: Asuc_0536Help
Entry
Asuc_0536         CDS       T00558                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00030  Pentose phosphate pathway
asu00051  Fructose and mannose metabolism
asu00680  Methane metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
asu01230  Biosynthesis of amino acids
Module
asu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0536
   00030 Pentose phosphate pathway
    Asuc_0536
   00051 Fructose and mannose metabolism
    Asuc_0536
  09102 Energy metabolism
   00680 Methane metabolism
    Asuc_0536
Enzymes [BR:asu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Asuc_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ABR73911
UniProt: A6VLR4
Position
589929..591008
Genome map
AA seq 359 aa AA seqDB search
MAKLLDIVKPGVLTGDDVSKVFAYAKENGFAIPAVNCVGSDSVNAVLETAARVKAPVIIQ
FSNGGASFYAGKGVKPASGIRPDVLGAIAGAKHVHTLAAEYGVPVILHTDHCAKKLLPWV
DGLLDAGEKHFAETGKPLFSSHMLDLSEEPMEENMAICRKYLERMDKMGMTLEIEIGITG
GEEDGVDNSDVDESRLYTQPEDVLYVYDQLNPVSSRFTVAAAFGNVHGVYKPGNVKLKPS
ILGASQEFVAKERNLAAKPINFVFHGGSGSSTEEIREAIGYGAIKMNIDTDTQWAAWDGI
LQFYKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKMEESMSKRLEKSFQDLNCVDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattattagacatcgtaaaacccggcgtattaactggcgatgacgtttcaaaa
gtatttgcatacgcaaaagaaaacggcttcgcaattcctgcagtaaactgtgtgggctca
gactctgtcaacgctgttttagaaactgcagcacgtgtaaaagcgcctgtaattattcaa
ttctctaacggcggcgcttcattctacgcaggtaaaggcgtgaaacctgcaagcggcatt
cgtccggatgtgttaggtgctatcgccggtgcaaaacacgtacatactttagccgctgaa
tacggcgtgccggtgattcttcacaccgatcactgcgcaaaaaaattactgccatgggtg
gacggcttattagacgcaggtgaaaaacattttgccgaaaccggtaaaccgttgttctct
tcgcatatgctggatctttcggaagagccaatggaagaaaatatggcgatttgccgtaaa
tatctggaacgcatggacaaaatgggtatgacccttgaaatcgaaatcggtattaccggt
ggtgaagaagacggcgtagacaattctgatgtggatgaatcacgtttatatacccaaccg
gaagacgtattatatgtttatgatcaattaaatccggtaagttcccgttttactgtggct
gcggcatttggtaacgtacacggcgtttacaaaccgggcaacgtaaaattaaaaccgtct
atcttaggggcttcccaggaattcgtagcgaaagaacgcaatcttgcggccaaaccgatt
aatttcgtattccacggcggttcaggttcttcaaccgaagaaattcgcgaggccatcggc
tacggtgccatcaaaatgaacattgacaccgatacccaatgggcggcttgggacggtatt
cttcaattctacaaagcaaacgaagcttacctgcaaggtcaattaggcaaccctgaaggc
cctgacgcaccaaataaaaaatactatgatccgcgtgtttggttacgtaagatggaagaa
tccatgtctaaacgcttagaaaaatctttccaagatttaaactgcgtcgacgtattataa

DBGET integrated database retrieval system