KEGG   Actinobacillus succinogenes: Asuc_0677Help
Entry
Asuc_0677         CDS       T00558                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00051  Fructose and mannose metabolism
asu00562  Inositol phosphate metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
asu01230  Biosynthesis of amino acids
Module
asu_M00002  Glycolysis, core module involving three-carbon compounds
asu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0677
   00051 Fructose and mannose metabolism
    Asuc_0677
   00562 Inositol phosphate metabolism
    Asuc_0677
Enzymes [BR:asu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asuc_0677
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asuc_0677
  Exosomal proteins of bladder cancer cells
   Asuc_0677
  Exosomal proteins of melanoma cells
   Asuc_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABR74050
UniProt: A6VM53
Position
complement(737797..738567)
Genome map
AA seq 256 aa AA seqDB search
MASRKPLVMGNWKLNGSKAFTRELIEGLKTELAGVEGCDVAIAPPVMYLAEAETALADSK
IALGSQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKFSALKE
AGLTPVLCIGETEEENEAGKTEEVVSRQIDAVINALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRAHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAAAAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcgtaaaccattagtaatgggtaactggaaattaaacggcagtaaagcgttc
accagagaattaatcgaaggcttaaaaaccgaactggccggcgtagaaggctgtgacgtc
gctatcgcaccgccggtaatgtacttggctgaagcggaaaccgcgcttgccgacagcaaa
atagccttaggttcacaaaatgtggacgtaaacgtaaaaggcgcgttcaccggtgacatc
tctaccgaaatgttaaaagatttcggtgcgaaatatatcattatcggtcattccgagcgc
cgtacttatcacaaagaaagtgacgaattcatcgcgaaaaaattctccgccttaaaagaa
gcgggtttaaccccggttttatgtatcggtgaaaccgaagaggaaaatgaagcgggcaaa
acggaagaagtggtttcccgtcaaattgatgccgtcatcaacgctttaggcgtagaagcc
tttaacggtgcggttatcgcttatgaaccgatttgggcaatcggtaccggcaaatccgcc
actccggctcaggcacaagcggtgcatgcttttattcgcgctcatattgcggcgaaatct
caagcggtagcggatcaagtcatcatccaatacggcggttccgtaaacgatgcaaacgca
gccgaactgttcacacaaccggatattgacggtgcattagtgggcggcgcgtcattaaaa
gctcccgcgttcgcagtaatcgtaaaagccgcggcggcagcgaaggcttaa

DBGET integrated database retrieval system