KEGG   Actinobacillus succinogenes: Asuc_1106Help
Entry
Asuc_1106         CDS       T00558                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_1106
Enzymes [BR:asu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Asuc_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MCR_alpha_N
Motif
Other DBs
NCBI-ProteinID: ABR74472
UniProt: A6VNC5
Position
complement(1229086..1229892)
Genome map
AA seq 268 aa AA seqDB search
MKRKFIQNIDTGITLYQYNEIPVIEVEHAVGSAKIALQGAHLLSWKPNGAQHDVLWLSEI
EPFKAGNAIRGGIPVCFPWFNNAGTPAHGYARIRLWQLRSHQIMPDSVQLIFTLNNEKNL
PVATLDMTFAADCRLTFTNTGEKNAQIALHSYFNVSDIRRIVLLNLPDSAYNSLTQQQEN
VPTPRTVGENVDCIYRAESGATVIDDPIYQRQIEVEHQNAGDIVLWNPWHKATGNMSETG
YQTMVCVETARIRRRINRESVGVIIRVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaaatttattcaaaatattgacacaggcattacgctttatcagtacaacgaa
attcccgttattgaagtggaacatgcggtgggctcggcaaaaattgcgctgcaaggcgcc
catttattaagctggaaaccgaacggcgcacaacacgacgtactctggttgagtgaaatc
gaaccgttcaaagcgggcaatgccattcgcggcggcatacccgtttgctttccctggttc
aacaatgctggaacaccggcgcacggttacgcccgcattcggttatggcagctgagatcg
catcaaataatgccggactccgttcaacttattttcacactaaataacgaaaaaaacctc
cccgttgccacacttgacatgacttttgccgcggattgccgtctgacgtttaccaatacg
ggagaaaaaaatgcgcaaatcgccctgcacagttatttcaatgtgagcgatattcggcgg
atcgtattactgaatctgccggattccgcctataattccctcacgcaacaacaggaaaat
gtaccgacgccaagaaccgtcggtgaaaacgtggactgcatttatcgcgccgaatcaggc
gcaactgtcattgacgatccgatatatcagcgtcaaattgaagtagaacatcaaaatgcc
ggcgatattgtcctgtggaatccgtggcataaagctaccggcaatatgagcgaaaccggt
tatcaaaccatggtttgcgtggaaaccgcaagaatccgccgacgaattaaccgagaatcc
gtgggcgtcattattcgcgttaaataa

DBGET integrated database retrieval system