KEGG   Actinobacillus succinogenes: Asuc_1410Help
Entry
Asuc_1410         CDS       T00558                                 

Definition
(GenBank) HAD superfamily (subfamily IIIB) phosphatase, TIGR01672
  KO
K03788  acid phosphatase (class B) [EC:3.1.3.2]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00740  Riboflavin metabolism
asu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Asuc_1410
Enzymes [BR:asu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     Asuc_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acid_phosphat_B Hydrolase HAD_2 Hydrolase_like Pathogen_betaC1 Nmad2
Motif
Other DBs
NCBI-ProteinID: ABR74769
UniProt: A6VP72
Position
complement(1571246..1571977)
Genome map
AA seq 243 aa AA seqDB search
MSLIKSSVFMFSMLTIAVSANAKGPKVSYDHAGITAIDHKNEAQVKWVSAESIQKELKGK
PPITVSFDIDDTVLVSSQCFYYGKQTFSPDSLDYLHNQAYWDFVADGCDNYSIPKESAKK
LIDMHQARGDQVIFITGRTPHRLHKAGQMDQLARILERAFHIKNMKPINYTHDKPIAPYK
YDKTRFMVENRVSIHYGDSNDDILAAREAGIRGIRVIRSATSTNRPLPLNGGYGEEVVED
SSY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgattaaatcaagcgtttttatgttcagtatgctgactatcgctgtatctgca
aatgcgaaagggcctaaggtgagttacgatcatgcgggtattaccgctatcgatcataaa
aatgaagcacaggtaaaatgggtttcggcggaatccattcaaaaagaattaaagggtaaa
ccgcctattacggtgagttttgatattgatgataccgtattggtttcttcacaatgtttc
tattacggcaaacaaactttttcaccggatagtctggattatttacataatcaggcatat
tgggattttgtagcggacggctgtgacaattattcgattccgaaagaatctgcaaaaaaa
ttaattgatatgcaccaagcacgcggtgatcaggtcatttttattaccggccgtacgccg
catcgattacataaagcagggcaaatggatcaattagcccgcattctcgaacgtgcgttt
catattaaaaatatgaaaccgatcaactatacccatgacaaaccgattgcaccgtataaa
tacgataaaacccgttttatggttgaaaaccgcgtcagcattcattatggcgacagcaac
gatgatatattggctgcacgtgaagccggaattcgcggcatccgtgttattcgatcggca
accagcactaaccgcccgttaccgctgaacggcggttacggcgaagaagtggtcgaggat
tcgtcatattaa

DBGET integrated database retrieval system