KEGG   Actinobacillus succinogenes: Asuc_1445
Entry
Asuc_1445         CDS       T00558                                 

Definition
(GenBank) protein of unknown function DUF1047
  KO
K09911  uncharacterized protein
Organism
asu  Actinobacillus succinogenes
Brite
KEGG Orthology (KO) [BR:asu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Asuc_1445
SSDB
Motif
Pfam: MatP MatP_C RHH_4 DUF2199 DUF2288 LSM
Other DBs
NCBI-ProteinID: ABR74804
UniProt: A6VPA7
Position
1607039..1607488
AA seq 149 aa
MKYQKLKNQEAQWKWRYLIKKNRDGEAITRYDERSLADAKVAELLKAQNYPEQIENWIAD
NMAENLVIKLDQAIRARRKRFFNAEKQSTKKKSIDLEYGVWSRLSKYSRKMNMTLSETIS
YMIDERESKALYESQMSAMKAGLKDLLKK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaagtatcaaaagctgaaaaatcaagaagcgcaatggaaatggcgttatcttatcaag
aaaaatcgagacggtgaagctatcacccgttacgacgaacgtagtctggcggatgccaaa
gtggcagaactgctgaaggcgcaaaattaccccgagcaaattgaaaactggattgccgac
aacatggctgaaaatctggtgattaaactggatcaggctattcgcgcccgccgtaaacgt
ttttttaacgcggaaaagcaatcgaccaagaagaaatctattgatttggaatatggcgta
tggtctcgcttatcaaaatactcccgcaaaatgaacatgacgctgtcggaaactatttcc
tacatgattgacgaacgtgaaagcaaagcgctctacgaatctcagatgtccgcgatgaaa
gcaggtttaaaagatttattaaaaaaataa

DBGET integrated database retrieval system