KEGG   Actinobacillus succinogenes: Asuc_1751Help
Entry
Asuc_1751         CDS       T00558                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00900  Terpenoid backbone biosynthesis
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Asuc_1751
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Asuc_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABR75103
UniProt: A6VQ56
Position
1923611..1924519
Genome map
AA seq 302 aa AA seqDB search
MKKNYRFSTALSQFSADSFRQGKSLRFPSPAKLNLFLYINGKRADGYHELQTLFQFLDYG
DWLEISARADGEIHLTPQLPGVKEEDNLIYRAAHILQQNTGCTLGADIRLDKILPMGGGV
GGGSSNAATVLVALNYLWKTRLSLSELADLGVKLGADVPIFIHGNAAFAEGVGEKLTDCE
PPEKWFVVLKPETSISTALVFTHPDLPRNTPKRPLTRLLTEEYGNDCEKVVRNCYPEVEE
TLTWLLKYAPSRLTGTGACVFAEFDNEKSAQAVFDMKPASVSGFVAKGCNRSPLHQWLDK
IS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaattatcgattttcaaccgcactttcccaattttccgccgactctttccgc
caaggaaaatctttgcgtttccccagccccgccaaattgaacttatttttatatattaac
ggaaaaagggcggacggttatcacgagctgcaaacactttttcagtttttagattacggc
gattggctggaaatcagtgcgcgcgccgacggtgaaattcatctaaccccccaattaccc
ggtgtgaaagaagaagataatttaatttaccgcgcggctcacatattacaacaaaacacc
ggttgcaccctcggtgccgatatacggctggacaaaattctgcctatgggcggcggtgtc
ggcggcggttcgtccaatgcggcaaccgtattggtagcgttaaattatctctggaaaacc
cgcctctctctctcagaacttgccgatttaggcgtaaaattaggtgccgacgtgccgatt
tttattcacggtaacgccgcttttgcggaaggtgtcggcgaaaaattaacggattgcgaa
ccgcctgaaaaatggtttgtggtgctcaaacccgaaacctctatttccacggcgcttgtc
ttcacccatccggacttaccgcgaaatacgccgaaacgtccgctaacacggctattaacc
gaagaatacggtaacgattgcgaaaaagttgtacgaaattgttatcccgaggttgaagaa
acccttacgtggttgctaaaatatgcaccgtcaagattgacgggaaccggcgcttgcgtg
tttgcggaattcgataacgaaaaatccgctcaagccgtgtttgatatgaaacccgcttcg
gtttccggttttgttgcgaaaggctgtaatcgttccccgcttcatcagtggttagataaa
atttcgtga

DBGET integrated database retrieval system