KEGG   Actinobacillus succinogenes: Asuc_1831Help
Entry
Asuc_1831         CDS       T00558                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00450  Selenocompound metabolism
asu00970  Aminoacyl-tRNA biosynthesis
asu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Asuc_1831
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Asuc_1831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asu01007]
    Asuc_1831
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asu03016]
    Asuc_1831
Enzymes [BR:asu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Asuc_1831
Amino acid related enzymes [BR:asu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Asuc_1831
Transfer RNA biogenesis [BR:asu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Asuc_1831
 Prokaryotic type
   Other AARSs
    Asuc_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABR75182
UniProt: A6VQD5
Position
complement(2009275..2011332)
Genome map
AA seq 685 aa AA seqDB search
MSKANRQILVTCALPYANGPIHLGHMLEHIQADIWVRFQRMRGHEIYFVCADDAHGTPIM
LKADQMGIAPEQLIADVQKSHYADFCGFNISFDNYHSTHSEENREFSEMIYNRLKENGFI
KTRAISQLFDPEKSMFLPDRFVKGTCPKCKAEDQYGDNCEVCSATYSPTELIAPRSVVSG
ATPIIKESEHFFFDLPSFEAMLKQWNRSGALQSEVANKMQEWFDAGLQQWDISRDAPYFG
FKIPGTENKYFYVWLDAPIGYMASFKNLCNRQNIDFDRFWNKDSQAELYHFIGKDIMYFH
SLFWPAMLEGADLRKPSNIFVHGYVTVNGEKMSKSRGTFIQAATYLKHLDPECLRYYYAA
KLSNRIDDLDLNLEDFVQRVNTDLVNKLVNLASRNAGFIQKRFAGKLADKLDDEALFNEF
IAQSAQIAAYYENREFGKAVREIMALTDKANKYVDEKAPWVIAKEQGRETELQRVCSMGI
QLFRVLMGYLKPVLPKLAERSEAFLQAELTWDNLTQPLLDHEIAPFKALFSRVDSKQIEA
MIEASKAENAAVNSSPKAEKTAKKTTALESEFEPLEAEISIDDFAKMDLRVAKVISCEAV
PESKKLLKFQLDLGFETRQVLSGIKAAYGNPEELMGRFVIMVANLAPRKMKFGMSEGMIL
SAGSGGEDLFLLDVDAGVKAGSRVK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaaaccgtcaaattcttgttacgtgtgcgttgccgtatgcaaacggtccg
attcatttaggtcatatgcttgaacatattcaggcggatatttgggtacgctttcaacgt
atgcgcggtcatgaaatctattttgtgtgtgccgatgatgcacacggcacgccgattatg
ctgaaagccgatcaaatgggcattgcgccggaacaattgattgccgacgtccaaaaaagc
cattatgcggatttttgcggctttaacatcagtttcgataactaccattccacgcacagc
gaagaaaaccgtgaattttccgaaatgatttataatcgattgaaagaaaacggttttatt
aaaacccgtgccatctcccagctgtttgacccggaaaaatccatgtttctgcctgatcgt
ttcgtgaaaggtacttgtccgaaatgtaaagcggaagatcagtacggcgataattgcgaa
gtctgttccgcaacatacagcccgacggaattgattgcccctcgttccgtggtatccggg
gcgacgccgattatcaaagaaagcgaacattttttctttgatttaccgagttttgaggcg
atgctaaaacaatggaatcgttccggcgcattgcaatcggaagtggcgaacaaaatgcaa
gagtggtttgatgccggcttgcaacaatgggatatttcccgcgacgcaccgtatttcggt
tttaaaattccgggtacggaaaacaaatatttctacgtctggttggacgcgccgatcggt
tatatggcgtccttcaaaaacttatgtaaccgccaaaatatcgactttgatcgattctgg
aacaaagacagtcaggcggaactttatcacttcatcggcaaagatatcatgtatttccac
agtctgttttggccggcaatgttggaaggggcggatttacgcaagccgagcaatattttc
gtacacggttatgtgacggtaaacggtgaaaaaatgtccaaatcccgcggtacctttatt
caggcggcaacctatctgaaacatttggatccggagtgcctgcgttactattatgcggca
aaactcagcaaccgtattgatgatttggatttgaatctggaagatttcgtacaacgggtt
aataccgatttagtcaataaactggtgaatttagcgtcgcgtaacgccgggtttattcaa
aagcgctttgccggtaaattagcggataaattggatgatgaagccttattcaacgaattt
atcgcacaatcggcacaaatcgccgcatattatgaaaatcgagagttcggcaaagctgtg
cgggaaattatggcattaaccgataaagccaacaaatatgtagacgaaaaagcaccttgg
gtgatagccaaagaacaaggtcgcgagaccgaattgcagcgggtttgttccatgggcatt
caactgttccgcgtattaatgggctatttgaaaccggtcttgcctaaattggcggaacgt
tcggaagccttcttacaggcggaattaacttgggataatttaacgcaaccgttattagat
cacgaaattgcgccgtttaaagcattgttcagccgggtcgatagtaaacaaatcgaagcg
atgattgaagcgtctaaagcggaaaacgcagcggtgaattcatctccgaaggctgaaaaa
acagcgaaaaaaacgaccgcacttgaaagtgaattcgaaccgctggaagcggaaatcagc
attgacgattttgccaaaatggatttacgggtggcaaaagtgatcagttgcgaagcggtg
ccggaaagtaaaaaattgctgaaattccagttggatctcggttttgaaacccgccaggtt
ttatcaggcattaaagccgcttacggaaaccctgaagagttgatgggacgttttgtaatc
atggtggcaaatcttgcaccccgtaaaatgaaattcggtatgtcggaaggcatgattttg
tctgccggcagcggcggcgaggatttattcctgttggatgtagacgctggcgtcaaagcg
ggcagccgggtaaaataa

DBGET integrated database retrieval system