KEGG   Acetobacter oryzifermentans: WG31_06155Help
Entry
WG31_06155        CDS       T04478                                 

Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
asv  Acetobacter oryzifermentans
Pathway
asv00130  Ubiquinone and other terpenoid-quinone biosynthesis
asv01100  Metabolic pathways
asv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    WG31_06155
Enzymes [BR:asv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     WG31_06155
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     WG31_06155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 CMAS PrmA MTS TehB Methyltransf_9 TPMT Methyltransf_4 tRNA_U5-meth_tr AdoMet_MTase Methyltransf_32 Ubie_methyltran Methyltransf_16 NodS MetW DREV
Motif
Other DBs
NCBI-ProteinID: ANA13651
Position
complement(1274257..1274997)
Genome map
AA seq 246 aa AA seqDB search
MHATREEAPSSVSSEEIARFSALADKWWDPTGPMRPLHAMNGLRIEWASRHLPLRGRKSR
KPHVLDIGCGAGLASEALAKAGYNVLGLDASANGIAAAQAHLEANPLPAGSGTLHYRQGS
AEELVAEHAKFDAVMALEIIEHVTDPEAFMVMLAQLVDANGTIIVSTMNRTLRSLAVGKI
GAEYLLRLLPVGTHEWRKFIQPSELGRYARAAGLRMVAISGMAPGIGSWKETQDLGINYI
AAFKKD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccacccgagaggaagcgccttcctctgtttcttccgaggaaattgcccgcttt
agtgctctggcagacaagtggtgggatccaacaggccccatgcgcccccttcatgccatg
aacggcctgcggattgaatgggccagccgccacctgcccctgcgtggccgcaaatcacgc
aagccgcatgtgctggatattggctgtggcgcggggctggctagtgaagccctggcaaaa
gccggatataacgtattggggctggatgcatcggccaatggtattgccgctgcacaggcg
catctggaagccaacccgcttcctgccggttctggcacgctccattatcgccaaggcagc
gcggaagaactggtggccgaacacgccaagtttgatgctgtaatggctttagaaattata
gagcatgtgactgatcctgaagcatttatggttatgctggctcaacttgtagatgccaat
ggcacaatcattgtttctaccatgaaccgcaccctgcgctccttggctgtcggcaagatt
ggggcggaatatttgctgcgcctgctacctgttggcacacacgaatggcgcaagtttatc
cagccttccgaactggggcgctatgcccgcgccgctggcctgcggatggttgccatttct
ggcatggcccccggcattggcagctggaaagaaacgcaggacttgggcattaactacatc
gctgccttcaaaaaagactga

DBGET integrated database retrieval system