KEGG   Acetobacter oryzifermentans: WG31_09630Help
Entry
WG31_09630        CDS       T04478                                 

Definition
(GenBank) magnesium transporter
  KO
K06195  ApaG protein
Organism
asv  Acetobacter oryzifermentans
Brite
KEGG Orthology (KO) [BR:asv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WG31_09630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANA14226
Position
2027570..2028040
Genome map
AA seq 156 aa AA seqDB search
MPDWATSPLLQDPEEAMNELFSSLPVYEAVTEHVRVQVQVFWLPDQSEPDEHSYCWAYRI
RIGNDGTQPVQLLERTWHITDTAGHTEYVHGSGVVGELPVIQPGALYEYTSGASLTTPGG
FMSGHYLMQDKSSGRRFDVSIPAFSLDSPFLLRQIH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactgggccacttctccccttttgcaagatccagaagaagccatgaacgagcta
ttctcctcactgcccgtctatgaggccgttacggagcatgtgcgcgtacaggtacaggtg
ttctggctgccagatcaatccgaaccagatgagcattcctactgctgggcctatcgtatc
cgtattggcaatgatggtacccagcctgtgcaacttctggaacgtacatggcacattacg
gatacagccgggcacacagaatatgtgcacggttctggcgtagtgggagaactgccggtt
attcagcccggtgcgctttatgaatatacctccggggcatcccttaccacgccgggcgga
tttatgagcggacactacctgatgcaggataaaagcagcggcagacggtttgatgtcagc
attcctgcttttagcttggacagtccttttctgctccgccagattcactaa

DBGET integrated database retrieval system