KEGG   Achromobacter spanius: CVS48_04220Help
Entry
CVS48_04220       CDS       T05274                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
asw  Achromobacter spanius
Brite
KEGG Orthology (KO) [BR:asw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CVS48_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AUA55305
UniProt: A0A0L0RAQ0
Position
complement(915227..915601)
Genome map
AA seq 124 aa AA seqDB search
MKPYDLSVSVSPRFVPEQSDPSEQQFVFAYTVRITNTGEHPAQVISRHWVITDGNQRVQE
VRGLGIVGQQPLLAPGETFEYTSGCPLPTPVGTMRGTYHCVGENGIPFEVPISEFVLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgacctgagcgtctctgtctctccgcgcttcgtgcctgaacagtctgat
cccagcgagcagcaattcgtctttgcctataccgtgcgcatcaccaataccggcgaacat
cccgcccaggtgatcagccgccactgggtcatcaccgacggcaaccagcgcgtgcaggaa
gtgcgtgggctgggcatcgtgggccagcagcccctgctggcgcccggcgaaaccttcgaa
tacaccagtggctgtccgctgcccacgccggtgggcaccatgcgtggcacctaccattgc
gtcggcgagaacggtatcccgttcgaagtgccgatctctgaattcgtcctggccatgcct
cgcaccctgcattga

DBGET integrated database retrieval system