KEGG   Achromobacter spanius: CVS48_07620Help
Entry
CVS48_07620       CDS       T05274                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
asw  Achromobacter spanius
Pathway
asw00970  Aminoacyl-tRNA biosynthesis
asw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CVS48_07620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:asw03029]
    CVS48_07620
Enzymes [BR:asw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CVS48_07620
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CVS48_07620
Mitochondrial biogenesis [BR:asw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CVS48_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AUA55914
UniProt: A0A3S4NGC5
Position
complement(1678069..1679595)
Genome map
AA seq 508 aa AA seqDB search
MTKPALHTQFEGIAALRAALAQRQVSAVELAQSALAAADAASGLNCFLHIDAELTLAQAR
AADAALADGSAGPLAGVPIAHKDAFVTRGWRTTAGSKMLDGYVSPFDATVVERLGLAGAV
SIGKLNCDEFAMGSGNENSAYGVVKNPWDHAAVPGGSSGGSAAAVAARLVAAATGTDTGG
SVRQPAALCGVSGIKPTYGTVSRYGMVAFGSSLDQAGPLAQSSRDLLELLDVISGFDPRD
ATSLEKCDAAVNEPGRVRRDFDAAQGKFDAAGSQPLKGLRIGVPEEYFGAGLAADVAAAV
EAALAQFEALGAVRVPVSLPRTELAIPAYYVIAPAEASSNLARYDGVRYGHRTKQYGDLN
EMISRSRAEGFGDEVKRRILIGTYVLSHGYYDAYYLQAQRLRRLIAQDFQRAYADQCDVI
MGPVTPSVAKNIGDNRDDPTADWLADVYTLGVSLAGLPAMSIPCGFGGDNGKRPVGLQII
GNYFDEGRLLAIADRYQQVSDWHKRSPL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacctgccttgcatacccaattcgaggggatcgccgccttgcgcgcggccctc
gcccaacgccaggtcagcgccgtcgaactggcgcaaagcgccttggcggccgccgatgcg
gccagcggcctgaattgctttttacatattgacgctgaattgacgctggcccaggcccgc
gccgccgacgccgccctggccgacggttcggccggccccttggccggcgtgcccatcgcc
cacaaagacgctttcgtgacccgcggctggcgcaccaccgccggcagcaagatgctggac
ggctacgtcagcccgttcgacgccaccgttgtcgagcgcctgggcttggcgggcgccgtg
tccatcggcaagctcaactgcgacgaattcgccatgggctccggcaacgagaattccgcc
tacggcgtcgtgaagaacccctgggaccacgccgccgttccgggcgggtcgtcgggtggc
tcggccgccgcggtggccgcgcgcctggtggccgccgccaccggcaccgacaccggcggt
tcggtgcgccagcccgccgcgctgtgcggcgtcagcggcatcaagcccacctacggcacc
gtgtcgcgctatggcatggtggctttcggatccagcctggaccaggcaggcccgttggcg
caaagcagccgcgacctgcttgaactgctggacgtcatcagcggctttgatccgcgcgac
gccaccagccttgaaaagtgcgatgccgccgtgaacgagcccggccgcgtccgccgcgac
ttcgacgccgcgcaaggaaagttcgacgctgccggcagccagcccctgaagggcctgcgc
atcggcgtgcccgaagaatatttcggcgccggcctggcggccgatgtggccgccgcggtg
gaagccgcgctggcccagttcgaagcgctgggcgccgtgcgcgtgccggtctccctgccc
cgcacggaactggccatcccggcgtactacgtcattgccccggcggaagcgtccagcaac
ctggcccgctatgacggcgtgcgctacggccaccgcaccaagcaatacggcgatttgaac
gagatgatcagccgctcgcgcgccgaaggcttcggcgacgaggtcaagcgccgcatcctg
atcggcacgtacgtgctgtcccacggttactacgacgcctattatttgcaggcacagcgc
ctgcgccgtctgatcgcgcaagatttccagcgcgcctacgccgaccagtgcgacgtcatc
atgggcccggtcacgccgtcggtcgccaagaacatcggcgacaaccgcgacgaccccacc
gccgactggctggccgacgtctacacgttgggcgtgagcctggccggtttgcccgcaatg
tcgatcccctgcggctttggcggcgacaacggcaagcgtccggtcggcctgcagatcatc
ggcaactacttcgatgaaggcaggctcctggccatcgccgaccgctaccaacaagtctcg
gactggcacaagcggtccccgctgtga

DBGET integrated database retrieval system