KEGG   Achromobacter spanius: CVS48_13275Help
Entry
CVS48_13275       CDS       T05274                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
asw  Achromobacter spanius
Pathway
asw00430  Taurine and hypotaurine metabolism
asw00460  Cyanoamino acid metabolism
asw00480  Glutathione metabolism
asw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CVS48_13275
   00460 Cyanoamino acid metabolism
    CVS48_13275
   00480 Glutathione metabolism
    CVS48_13275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:asw01002]
    CVS48_13275
Enzymes [BR:asw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CVS48_13275
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CVS48_13275
Peptidases and inhibitors [BR:asw01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CVS48_13275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AUA56910
UniProt: A0A3S4RUU1
Position
complement(2923572..2925407)
Genome map
AA seq 611 aa AA seqDB search
MSASFTTRPEIRGTFGVVSSTHWLASQVAMGVLERGGNAYDAAVAGGFTLQIVEPHLNGP
GGEVPILFWSENEQRMRALCGQGPAPALATPAAFRALGVEMVPGIGLLPATVPGAFGAWL
TLLRDYGTWELADVLRPAIDYARHGFPLVPRVSQAVLAVQALFRDEWTTSRDVWMPDDRV
PAPDSLFRTPAIADTYTRILNEAHAASSDRIGRIDAALNCWYRGFVADAIDTYYTEAEVR
DTTGQRNRGLLRKADMADWRATYDEPVTTQYGRYTVAKCGVWSQGPVHLQQLAMLRHLGM
EGLDPTSPEFVHRIAEAAKLAFADRAAWYGDPDFTPVPLTALLSDAYARERAALIDTTAS
TVLRPGSPDGLAPRLPDLGAADRTLAASDTRFGVGEPTFAALPPVAEWAAREIFVGDTCQ
IDVIDRDGNMVAATPSGGWLSSSPVVPGLGFPLTTRLQMTWLDDGVPGQLQAGKRPCTTL
SPGLVLRDGQPYMAFGTPGGDQQDQWTVAFFLRHAMGMNLQEAIDAPSWHIDHFPGSFWP
RTQTLNRLTVESRLPEATIEALRAAGHDVKVGPAWSEGRISACTREPIAGGGLLLRAGAN
PRGMQGYAVGR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctccttcaccacccgtcctgaaatacgcggcaccttcggtgttgtgtcgtcc
acgcattggctggcatcgcaggtggccatgggggtgctggaacgcggcggcaacgcctat
gacgcggccgtggccgggggcttcacgctacagatcgtggagccgcacctgaacggcccg
ggcggcgaagtgcccattctgttctggagcgaaaacgaacaacgcatgcgcgcgctatgc
ggccaagggcccgcccccgcgctggccacgcccgccgcgttccgcgcgctgggcgtggaa
atggtgcccggcatcggcctcttgcccgccacggtccccggcgctttcggcgcctggctg
acgctgctgcgcgactacggcacgtgggaactggccgacgtgctgcgccccgccatcgac
tacgcccgccacggtttcccgctggtgccgcgcgtgtcgcaggcggtgctggccgtgcag
gcgctgtttcgtgacgaatggaccacctcgcgcgacgtctggatgcccgatgaccgcgtt
cccgcgccggattccctgtttcgcacgcccgccatcgccgacacgtacacgcgcatcctg
aatgaagcgcatgccgccagcagtgatcgcatcggccgcatcgatgcggccttgaactgc
tggtatcgcggctttgtcgccgacgccatcgacacctactacaccgaagccgaagtgcgc
gacaccaccggccagcgcaatcgcggactgctgcgcaaggccgacatggccgactggcgc
gccacctacgatgagcccgtcaccacgcagtacggccgctataccgtggccaagtgcggc
gtatggtcgcaagggccggtgcatttgcagcaattagcgatgctgcggcatctgggcatg
gaaggcctggaccccacatcgcccgaattcgtgcaccgcattgccgaagcggccaagctg
gcgttcgcggaccgcgccgcctggtatggcgaccccgacttcacgcccgtgcccttgacc
gcactgctcagcgacgcctatgcgcgcgagcgcgctgccctcatcgacaccaccgcgtcc
accgtgctccggcccggcagccccgatgggcttgccccccgcctgcctgacctgggcgcc
gccgaccgcacgctggccgcttccgacacgcgcttcggcgtgggcgagcccacgttcgcg
gccttgccgcccgtggccgagtgggccgcgcgcgaaatcttcgtgggcgacacctgccag
atcgacgttatcgaccgcgacggcaacatggtcgccgccacgccctcgggcggctggctg
tcgtccagccccgtcgtgcccggcctgggctttccgctgacgacccggttgcaaatgacc
tggctggacgatggcgtgcccggccaactgcaagccggcaagcgcccctgcaccacgctg
tcaccgggcctggtgttgcgcgacgggcaaccttatatggcgttcggcacgccgggcggc
gaccagcaggaccaatggaccgtggcgttcttcctgcggcacgccatgggcatgaatttg
caagaagccatcgacgcgccgtcgtggcacatcgatcatttcccgggctcgttctggccg
cgcacgcaaacgctgaaccggctgacggtggaatcacgcttgcccgaggccaccatcgaa
gcgctgcgcgccgccggccacgacgtcaaggtcggaccggcctggtccgaaggacgcatc
agcgcctgcacgcgcgaacccatcgcgggcggcggcctgctgctgcgcgcgggggccaat
ccgcgcggcatgcagggctacgccgtggggcgctga

DBGET integrated database retrieval system