KEGG   Achromobacter spanius: CVS48_14270Help
Entry
CVS48_14270       CDS       T05274                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
asw  Achromobacter spanius
Pathway
asw00020  Citrate cycle (TCA cycle)
asw00620  Pyruvate metabolism
asw00650  Butanoate metabolism
asw01100  Metabolic pathways
asw01110  Biosynthesis of secondary metabolites
asw01120  Microbial metabolism in diverse environments
asw01130  Biosynthesis of antibiotics
asw01200  Carbon metabolism
Module
asw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVS48_14270
   00620 Pyruvate metabolism
    CVS48_14270
   00650 Butanoate metabolism
    CVS48_14270
Enzymes [BR:asw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CVS48_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AUA57088
UniProt: A0A3S4MQW1
Position
3133569..3135086
Genome map
AA seq 505 aa AA seqDB search
MHLDRIRHPGLLAKITSADQAALLIQDGMTVGMSGFTRAGDCKSVPAALASRAEREPLSI
TLITGASLGHDTDKMLAQANALARRMPFQVDTTLRRKINQGEIAFIDQHLSETVEQLRAG
HIGPINVAIIEAAAITETGAIVPTMSVGNSASFAQQAHKIIIELNVGVPAAIEGLHDIYV
PAERPARQPIGLMSVDQRIGQPFIQVDPDKIAAIVITHEPDSPSNALPPDEDTNAIAGHI
NTFLRGEVDAGRLTNALLPLQAGIGTIANAVLHGFESSDFDALTMYSEVLQDSAIELLDQ
GKLAFASASSITVSKPVYDKILANMEHYRERIVLRPQEISNAPEVVRRLGVIAINTALEF
DIYGNVNSTHVGGTHMMNGIGGSGDFARNAHLAIFVSKSMAKNGDISSVVPMVSHVDHTE
HDVDVLVTECGLADLRGLAPRERARAIIRHCVHPSYRAALQDYFDRACERGGQTPHLLEE
AFSWHQRFNETDSMLPAKSSARKAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgaccgtattcgccatcctggcctgctcgccaagatcacgtccgccgaccag
gcggcattgttgattcaggacggcatgaccgtgggcatgagcgggttcacccgtgcgggc
gactgtaagtccgtgccggcggcgctggccagccgcgcggaacgcgagccgctgtcgatc
acgctgatcaccggcgcgtcgctaggtcacgatacggacaagatgctggcccaggcgaat
gcactggcgcgccgcatgccgttccaggtcgacacgacgttgcgacgcaagatcaaccag
ggcgagatcgctttcattgatcagcacctgtctgaaacggtggagcagttgcgggccggc
catatcggaccgatcaacgtggctatcatcgaagccgccgccatcacggaaaccggcgcg
attgtgcccacgatgtccgtgggcaattcggcgtcgttcgcgcagcaggcccacaagatc
atcatcgagctgaacgtcggcgtgcccgccgccatcgaagggttgcacgacatttatgtg
ccggccgagcgcccggcgcgccagcccatcggtctgatgtcggtggaccaacgtatcggc
cagcctttcattcaggtcgaccctgacaagatcgcggcaatcgtcatcacgcacgaaccc
gacagcccgtccaacgccctgccgccggacgaagacaccaacgccattgccggccacatc
aatacgtttttgcggggcgaagtggatgccggtcgcctgaccaatgcgctgctgccgctg
caggcaggcattggcaccatcgccaacgccgtgctgcatggttttgaatcgtcagacttc
gacgcgctgaccatgtattccgaagtgctgcaagacagcgccatcgaattgctggaccaa
ggcaagctggcgttcgcgtcggcctcgtccatcaccgtgtccaaaccggtgtacgacaag
atcctggccaacatggagcactaccgcgaacgcatcgtgctgcgcccgcaggaaatcagc
aacgcgcctgaagtcgtccgtcgcctgggggtcatcgcgatcaatacggctttggagttc
gatatctacggcaacgtgaattccacgcatgtgggcggcacgcacatgatgaacggcatc
ggcggctccggcgattttgcgcgcaatgcccatctggcaatcttcgtttccaagtccatg
gccaagaacggcgacatttccagcgtggtgccgatggtgtcgcatgtggaccataccgag
cacgacgttgatgtgctggtcaccgaatgtggcctggctgacctgcgcgggttggcgcct
cgcgagcgcgctcgcgccatcatccggcattgcgtgcatccgtcctaccgcgccgccttg
caagattattttgaccgcgcgtgcgaacgtggcgggcaaacgccgcatcttctggaagag
gcgttttcatggcatcagcgtttcaacgaaacggattccatgctgccggccaagtcctcg
gcccgcaaggcggcctga

DBGET integrated database retrieval system