KEGG   Achromobacter spanius: CVS48_14750Help
Entry
CVS48_14750       CDS       T05274                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
asw  Achromobacter spanius
Pathway
asw00230  Purine metabolism
asw00250  Alanine, aspartate and glutamate metabolism
asw01100  Metabolic pathways
Module
asw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CVS48_14750
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CVS48_14750
Enzymes [BR:asw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CVS48_14750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AUA57168
UniProt: A0A2K8S5C4
Position
3244329..3245636
Genome map
AA seq 435 aa AA seqDB search
MIRNMSKNVVVIGTQWGDEGKGKIVDWLAESVQGVVRFQGGHNAGHTLWINGKKTILRLI
PSGIMHPGVTCFIGNGVVLSPEALLKEIEELEAAGLDVRSRLQISEICPLILPYHVAIDK
AREARKGEGKIGTTGRGIGPAYEDKVARRALRVQDLFNPSLFDEKLAEVLDYHNFVLTKY
LGAEAVSADEVRDQAMALAPAIAPMVKDVSSNLYAMQQEGKRILFEGAQGALLDVDHGTY
PFVTSSNCVAGAASAGAGVGPQQLDYVLGITKAYTTRVGSGPFPTELVDEIGTRLATIGK
EFGSVTGRPRRCGWFDGAALKRSVRLNGISGLCITKLDVLDGLETIQLGVGYRVNGEFRD
VLPYGAHAVAQAQPVLEELPGWSESTVGITEYDKLPAAARRYLERVAEVCGVPIDLVSTG
PDRNETIVLRHPLKG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtaacatgagcaagaacgtagtcgtaatcggcacccaatggggtgacgagggc
aagggcaagatcgtcgactggctggcggaatccgtccagggcgtggttcgctttcagggc
ggtcacaacgccggccatacgctgtggatcaacggcaagaagacgattctgcgcctgatc
ccgtcgggcatcatgcatcctggtgtcacctgctttattggcaatggcgtcgtgctgtcc
ccggaagctctgctcaaggaaatcgaagagctggaagctgcgggtctggacgtgcgttcg
cgcctgcagatttccgaaatctgcccgctgatcctgccttatcacgtggccatcgacaag
gcgcgcgaagcgcgcaagggcgaaggcaagatcggcacgaccggtcgtggcatcgggccg
gcgtacgaagacaaggtcgctcgtcgcgcactgcgcgtgcaggacctgttcaatccgtcg
ctgtttgacgagaagctcgccgaagtgctggattaccacaacttcgtgctgaccaagtac
ttgggtgccgaggcagtgtcggccgacgaggtacgcgatcaggccatggcgttggctcca
gccattgcgccgatggtcaaggacgtgtcgagcaacctgtatgcaatgcagcaggaaggc
aagcgcattcttttcgaaggtgcgcagggcgccttgctggacgtcgaccatggcacgtac
ccctttgtcaccagcagcaattgcgtggctggtgccgcgtccgcgggtgctggcgtaggc
ccgcagcagttggattacgtgctgggtatcaccaaggcgtacaccacccgcgtcggttcg
ggcccgttccccacggaattggttgacgagatcggcacccgcctggccaccatcggcaag
gaattcggttcggtcacgggccgtccgcgtcgctgcggctggtttgacggcgccgcactt
aagcgttcggtccgtctgaacggcatttccggcctgtgcatcaccaagctggacgtgctg
gacggtctggaaacgattcaacttggcgtcggctaccgcgtgaacggcgaattccgcgac
gtgctgccttacggcgcgcacgccgttgcgcaagcgcaaccggttctggaagaactgccg
ggttggtcggaatccaccgtcggcatcaccgagtacgacaagctgcccgccgcggcccgt
cgttacctggagcgcgttgccgaagtttgcggtgtgccgatcgacctggtgtcgacgggt
cctgaccgcaacgaaaccattgtcctgcgtcatcccctgaagggctga

DBGET integrated database retrieval system