KEGG   Alkalitalea saponilacus: CDL62_00340Help
Entry
CDL62_00340       CDS       T04906                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00860  Porphyrin and chlorophyll metabolism
asx01100  Metabolic pathways
asx01110  Biosynthesis of secondary metabolites
Module
asx_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDL62_00340 (hemN)
Enzymes [BR:asx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CDL62_00340 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ASB47709
UniProt: A0A1T5HSI7
Position
complement(95282..96652)
Genome map
AA seq 456 aa AA seqDB search
MISPSLIEKYNQPIPRYTSYPPATVFHDTFTSNDYIRMAEASNHEEPRAISLYIHIPFCT
RLCLYCGCNTLITNKQELMTEYLKALKKEITMVSQWLDKQRPVTQIHWGGGTPNVLSTDE
VASIMDLIHEKFSVSKETEIAMECHPAHIDINYLDNLFKMGFNRISLGIQDFNSEVLKTV
HRMPPAIPIEEIVQFIKESKIPLNLDFIYGLPLQTVEGFAETMQQAVNLQPDRLVTFSYA
HVPWVKPHQKTLEKTGLPSPEEKTAMYLSSYETITQNGYIPIGFDHYAKPDDELSAALKN
HQLHRNFQGYCTKSTTGQVYAFGMSGISQLSNAYAQNTKNIKAYVEAINNGIPATEKGYV
ITEEEKLTREVILELMCNNYLKWDELALRLNCHVDDLKKATAFSEEKIKTFIVDDLLINK
DDALEITDAGRFFTRNIASAFDPKLKAGPGQFSKSI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgattagtccgtccctcatagaaaaatacaatcaacccatcccccgttatacaagttat
ccaccggctacggtttttcatgatacctttacttcaaacgactatattcgaatggcagaa
gcgtcaaaccatgaagaaccgcgtgccatatccctgtatatccacattcctttttgcacc
agactttgtctctactgcggatgcaacacgctaattaccaacaaacaggagttaatgacc
gaatatctgaaagctcttaaaaaggagattacaatggtgagccaatggttggacaaacaa
agaccggtaacgcaaattcactggggaggcggtacgcccaatgtgctttcaactgatgaa
gtagcatcaataatggatttgattcatgaaaaattttcggtttcgaaagaaaccgaaatt
gccatggaatgccatcctgctcacatcgacataaactacctggataatcttttcaaaatg
gggtttaacaggataagcctgggaatacaagactttaacagcgaggtattaaaaacagta
caccgaatgcccccggccattcccattgaagagatagttcaatttataaaagagagtaaa
attcctctgaaccttgattttatatacggtttgccgctgcaaactgtagaaggttttgcc
gaaaccatgcaacaggctgttaatctgcaaccagacagactggtgaccttctcttatgca
catgtaccttgggtaaaaccgcatcaaaaaacactggaaaaaaccggacttccttcaccc
gaagaaaaaactgccatgtacctttcaagttacgaaacaattactcaaaacggatacatt
ccaattggtttcgaccattatgcaaaacccgacgatgaactgagcgcggctttaaaaaac
catcaacttcaccgaaattttcagggatattgcaccaaatcgacaacaggacaagtttat
gctttcgggatgtcaggcatcagtcagttaagcaatgcctacgcacaaaacaccaaaaac
ataaaagcatacgttgaagccatcaacaatggtattcctgcgacagaaaaaggatatgtc
attaccgaagaagagaaactaacccgggaggtcattctcgagttgatgtgcaataactac
ctcaaatgggatgaacttgcattgaggctcaattgccatgttgatgacctaaaaaaggct
accgcattttctgaagaaaaaattaaaacttttattgtcgatgatttgttgattaataaa
gatgatgcattggaaattacagacgcaggccggttttttacccgcaacatagcttcggcc
ttcgacccgaagctaaaagcaggccccggacaattttccaaaagcatttaa

DBGET integrated database retrieval system