KEGG   Alkalitalea saponilacus: CDL62_08970Help
Entry
CDL62_08970       CDS       T04906                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00670  One carbon pool by folate
asx01100  Metabolic pathways
asx01120  Microbial metabolism in diverse environments
asx01200  Carbon metabolism
Module
asx_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDL62_08970
Enzymes [BR:asx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CDL62_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ASB49261
Position
complement(2282488..2284158)
Genome map
AA seq 556 aa AA seqDB search
MKSDIEIAREVTLKPVSEIAERLGIRKDLLEPYGHFKAKLPLSIIDKERMKGKKLILVSA
ISPTPAGEGKTTISIGLSEGLNRIGKQTTVVLREPSLGPVFGIKGGATGGGHAQVVPMED
INLHFTGDFAAIEKANNLLAALIDNNIQNKNGSLGIDPRTVHWKRVMDMNDRALRHIIVG
LGGTTSGVPRETGFDITAASEIMAILCLAENFEDLKERIGRIFIGFTLNKKPVYARDLNA
QGAMAALLKDAIKPNLVQTLEGNPAIIHGGPFANIAQGTNSVLATKMGLTLSDYVVTEAG
FGFDLGAEKFLDIKCVSAGLQPDAAVLVATVRALKYHGGVPLSEINHPDAAAVERGLDNL
EKHVENMRKFNVCPVIAINHFADDTDAEINAIQQKCKDLGVKAAVAKVHALGGEGAEELA
AIVSEVAEACQSDLKPLYEWEWPVEKKIETIATKIYGAAAIDYTAQAKADLQKIYDLKLD
KLPVCIAKTQKSLSDNPKLLGRPENFVVTVREIEIAAGAGFIVPITGNIMRMPGLPEKPA
AENIDISSDGIISGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagacattgaaatagccagagaagtaaccctcaaacctgttagtgaaattgct
gaaagattaggcattagaaaagatttactggagccatatggccattttaaggccaaactt
cctttatcaattattgataaagagaggatgaaagggaaaaaactgatattggtttcagct
atttcaccaacacctgccggagaaggaaaaaccaccatctccattggcttgagcgaaggt
ttaaaccggataggaaagcagaccacggttgttctacgtgagccaagccttgggccggtt
tttggcataaaaggaggagctaccggcggaggtcatgcgcaggtggttcccatggaggat
attaatcttcactttaccggtgattttgctgccatcgaaaaggctaataatttattggca
gcacttattgataataacattcaaaacaaaaacgggtcgttgggtatcgatccccgaaca
gtgcactggaagcgggtaatggatatgaatgaccgggcattacgtcacatcattgtggga
ttgggaggaacaacctccggtgttcctcgcgaaaccggatttgatatcaccgcggcctct
gagattatggctattttgtgccttgcagagaattttgaagatttaaaggagcgtataggg
cgcatttttatagggtttacattaaacaaaaaaccggtttatgcccgtgatttgaatgca
caaggcgccatggctgccttgttaaaggatgccattaaacccaatctggtgcaaacactg
gaaggaaaccccgccatcatccacggcggaccttttgcaaacattgcacagggaaccaac
tcggtacttgccacaaaaatgggcttaactctttcggattatgttgtgacagaggctggt
tttggatttgacttgggtgcagaaaaatttctggatatcaaatgtgtgtcagccggtttg
cagcctgatgcggctgttttggtggctacggttcgggcactgaagtatcacggaggggtt
ccactctccgaaattaatcatcccgatgctgcggcagttgaaagagggttggataatctc
gaaaagcatgttgaaaacatgcgtaagtttaatgtttgtcctgtgattgccatcaaccac
tttgccgatgataccgatgccgaaatcaatgccatccaacagaaatgcaaagacctgggg
gttaaagcagctgtggcaaaagttcatgctttgggaggagagggagctgaagaattagct
gccatagtcagcgaagtggcggaggcgtgccaatcagatcttaagcctctttacgagtgg
gaatggccggttgagaagaaaattgaaaccatagccacaaaaatttatggtgctgcagcc
attgattatacagcgcaagccaaagcggatctccaaaaaatctacgatctgaaactagat
aaactcccggtttgtattgcgaaaacacaaaagtctctctcggataatccaaaactattg
ggtcgtccggaaaactttgtggtaaccgtaagagagattgaaattgctgcaggagcagga
tttattgttccaattaccggaaacattatgcgtatgcctggccttccggaaaagcctgct
gcagaaaacattgatatctcgtccgatggaataatttcagggttattttaa

DBGET integrated database retrieval system